DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and phb

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_989038.1 Gene:phb / 394635 XenbaseID:XB-GENE-977670 Length:272 Species:Xenopus tropicalis


Alignment Length:218 Identity:48/218 - (22%)
Similarity:93/218 - (42%) Gaps:43/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GPGVIFLVPCIDDLAVVDIRTRSFDLHRQEILT--RDMVTISIDGVVYY-----SIKSPFDAMLQ 147
            |.|..||:|.:....:.|.|:|..::   .::|  :|:..::|...:.:     .:...|.::.:
 Frog    51 GEGTHFLIPWVQKPIIFDCRSRPRNV---PVVTGSKDLQNVNITLRILFRPMGNQLPRIFTSIGE 112

  Fly   148 VYD----PEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKE 208
            .||    |...||.|.....|..||     :|::.:|.:|.|:...|......:|:.::.|.:..
 Frog   113 DYDERVLPSITTEILKSVVARFDAG-----ELITQRELVSRQVSEDLMERAATFGLILDDVSLTH 172

  Fly   209 IFMPDQLKRALAVEQEAMREA--------------KAKVAAAQGERDA----VTALKEAADIMET 255
            :....:...|:..:|.|.:||              ||.|.:|:|:..|    .|:|.:|.|.:  
 Frog   173 LTFGKEFTEAVEAKQVAQQEAERARFIVEKAEQQKKAAVISAEGDSKAAELIATSLADAGDGL-- 235

  Fly   256 NPIALQLRYLQTLNSICNDDTRS 278
                ::||.|:....|....:|:
 Frog   236 ----IELRKLEAAEDIAYQLSRA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 29/143 (20%)
SPFH_like 89..292 CDD:302763 48/218 (22%)
phbNP_989038.1 SPFH_prohibitin 27..221 CDD:259799 38/177 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.