DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and stoml2

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_957325.1 Gene:stoml2 / 394006 ZFINID:ZDB-GENE-040426-1139 Length:355 Species:Danio rerio


Alignment Length:203 Identity:66/203 - (32%)
Similarity:106/203 - (52%) Gaps:18/203 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPR--GPGVIFLVPCIDDLAVV-DIRT 110
            |.|..:||.:|           :.|..|:.|:||..    |  .||:.||:|.:|.:..| .::.
Zfish    37 LPMNTVVLFVP-----------QQEAWVVERMGRFH----RILEPGLNFLIPILDRIRYVQSLKE 86

  Fly   111 RSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDL 175
            ...|:..|..::.|.||:.||||:|..|..||.|...|.|||.|..:||.||:|:..|...|..:
Zfish    87 IVIDVPEQSAVSLDNVTLQIDGVLYLRILDPFKASYGVEDPEYAVTQLAQTTMRSELGKLTLDKV 151

  Fly   176 LSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQGER 240
            ...:|.|::.|...:..:::.||||..|.|||:|.:|.::|.::.::.||.|..:|.|..:.|.|
Zfish   152 FRERESLNSNIVHSINQASDEWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESGGTR 216

  Fly   241 DAVTALKE 248
            ::...:.|
Zfish   217 ESAINVAE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 53/161 (33%)
SPFH_like 89..292 CDD:302763 56/163 (34%)
stoml2NP_957325.1 PHB 45..199 CDD:214581 54/168 (32%)
SPFH_paraslipin 79..189 CDD:259811 39/109 (36%)
Band_7_C 264..326 CDD:292817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.