Sequence 1: | NP_649445.3 | Gene: | CG14644 / 40536 | FlyBaseID: | FBgn0250821 | Length: | 293 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957325.1 | Gene: | stoml2 / 394006 | ZFINID: | ZDB-GENE-040426-1139 | Length: | 355 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 66/203 - (32%) |
---|---|---|---|
Similarity: | 106/203 - (52%) | Gaps: | 18/203 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 LSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPR--GPGVIFLVPCIDDLAVV-DIRT 110
Fly 111 RSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDL 175
Fly 176 LSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQGER 240
Fly 241 DAVTALKE 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14644 | NP_649445.3 | PHB | 64..223 | CDD:214581 | 53/161 (33%) |
SPFH_like | 89..292 | CDD:302763 | 56/163 (34%) | ||
stoml2 | NP_957325.1 | PHB | 45..199 | CDD:214581 | 54/168 (32%) |
SPFH_paraslipin | 79..189 | CDD:259811 | 39/109 (36%) | ||
Band_7_C | 264..326 | CDD:292817 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |