DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and Stoml2

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001261161.1 Gene:Stoml2 / 37807 FlyBaseID:FBgn0034936 Length:366 Species:Drosophila melanogaster


Alignment Length:187 Identity:61/187 - (32%)
Similarity:101/187 - (54%) Gaps:7/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CLRVMSEYERAVILRLGRLRPKPPR--GPGVIFLVPCIDDLAVV-DIRTRSFDLHRQEILTRDMV 126
            |:..:.:.|..|:.|:||..    |  .||:..|||..|.:..| .::..:.|:.:|..:|.|.|
  Fly    42 CVMFVPQQEAWVVERMGRFH----RILDPGLNILVPVADKIKYVQSLKEIAIDVPKQSAITSDNV 102

  Fly   127 TISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILY 191
            |:|||||:|..|..|:.|...|.|||.|..:||.||:|:..|...:..:...:|.|:..|...:.
  Fly   103 TLSIDGVLYLRIIDPYKASYGVEDPEFAITQLAQTTMRSELGKMSMDKVFRERESLNVSIVDSIN 167

  Fly   192 NSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQGERDAVTALKE 248
            .::|.|||...|.||::|.:|.::..|:.::.||.|..:|.:..::|.|:|...:.|
  Fly   168 KASEAWGIACLRYEIRDIRLPTRVHEAMQMQVEAERRKRAAILESEGVREAEINIAE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 53/160 (33%)
SPFH_like 89..292 CDD:302763 55/163 (34%)
Stoml2NP_001261161.1 PHB 41..199 CDD:214581 53/160 (33%)
SPFH_paraslipin 80..188 CDD:259811 38/107 (36%)
Band_7_C 266..326 CDD:292817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.