DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and Phb

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_114039.1 Gene:Phb / 25344 RGDID:3322 Length:272 Species:Rattus norvegicus


Alignment Length:221 Identity:52/221 - (23%)
Similarity:91/221 - (41%) Gaps:49/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 GPGVIFLVPCIDDLAVVDIRTR---------SFDLHRQEILTRDMVTISIDGV--VYYSIKSPFD 143
            |.|..||:|.:....:.|.|:|         |.||....|..|.:.......:  :|.||...:|
  Rat    51 GEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYD 115

  Fly   144 AMLQVYDPEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRV------- 201
            ..:.   |...||.|.....|..||     :|::.:|.:|.|:...|......:|:.:       
  Rat   116 ERVL---PSITTEILKSVVARFDAG-----ELITQRELVSRQVSDDLTERAATFGLILDDVSLTH 172

  Fly   202 --------ERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQGERDAVTALKEAADIMETNPI 258
                    |.||.|:: ...:.:||..|.::|.::.||.:.:|:|:       .:||::: .|.:
  Rat   173 LTFGKEFTEAVEAKQV-AQQEAERARFVVEKAEQQKKAAIISAEGD-------SKAAELI-ANSL 228

  Fly   259 A------LQLRYLQTLNSICNDDTRS 278
            |      ::||.|:....|....:||
  Rat   229 ATAGDGLIELRKLEAAEDIAYQLSRS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 37/158 (23%)
SPFH_like 89..292 CDD:302763 52/221 (24%)
PhbNP_114039.1 SPFH_prohibitin 27..221 CDD:259799 42/185 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.