DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and sto-3

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_509941.1 Gene:sto-3 / 191966 WormBaseID:WBGene00006065 Length:267 Species:Caenorhabditis elegans


Alignment Length:255 Identity:111/255 - (43%)
Similarity:165/255 - (64%) Gaps:0/255 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PTCAEKTLFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPRGPGVIFLVPCIDDL 103
            ||..:....:.:...::|..|.|:|.|::::.||:|.||.|||||....|||||::.::|.||..
 Worm    12 PTFFDFVALICAWAFLLLTFPVSIFFCVKIVKEYDRMVIFRLGRLWQDNPRGPGIVLVLPFIDSH 76

  Fly   104 AVVDIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAG 168
            ..||:|..|:|:..||:||||.|||.:|..|||....|..::.:|.|...:|.:||.::||||.|
 Worm    77 KTVDLRVMSYDVPTQEMLTRDSVTIGVDAAVYYRTSDPIASLARVNDAHMSTRQLAQSSLRNVLG 141

  Fly   169 THKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREAKAKV 233
            |..|.:|::.:..::.|::.||.::|..|||.|||||||:|.:|.::.||:|.|.||.||:.|||
 Worm   142 TRSLAELMTDRHGIAVQVKYILDSATLFWGIHVERVEIKDIRLPREMCRAMAAEAEAQRESDAKV 206

  Fly   234 AAAQGERDAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFPFPVDIVRNLMK 293
            ..||||.||..|.::|||.:..:|.||||||||||..|...|..:.|.|||::.::..::
 Worm   207 VTAQGELDASMAFQKAADELAGSPTALQLRYLQTLVKISAHDNHTIVVPFPMEYIKKKIR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 70/158 (44%)
SPFH_like 89..292 CDD:302763 93/202 (46%)
sto-3NP_509941.1 PHB 37..196 CDD:214581 70/158 (44%)
SPFH_like 62..261 CDD:302763 93/198 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.