DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and sto-6

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_509943.1 Gene:sto-6 / 190619 WormBaseID:WBGene00006068 Length:298 Species:Caenorhabditis elegans


Alignment Length:265 Identity:123/265 - (46%)
Similarity:187/265 - (70%) Gaps:0/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RNVKTSENVPPTCAEKTLFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPRGPGV 93
            |.::.|:.|..|.....|.:.|.||.||.||.|:|.|::|..|||||||.||||::|...||||:
 Worm    18 RFMEMSDKVDFTACGWILTIFSYILAVLTLPISVFLCVKVAQEYERAVIFRLGRVKPGGARGPGL 82

  Fly    94 IFLVPCIDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKL 158
            .|:|||||....:|:||.||::..||:|::|.||:::|.||::.|.:...:::.:.|...:|:.|
 Worm    83 FFVVPCIDSYKKIDLRTLSFEVPPQELLSKDAVTVAVDAVVFFRISNATISVINIEDAARSTKLL 147

  Fly   159 AMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQ 223
            |.|||||:.||..|.::||.::.:|.|::..|..:|.|||::|||||:|::.:|.||:|.:|.|.
 Worm   148 AQTTLRNILGTKTLTEMLSDRDVISLQMQATLDETTIPWGVKVERVEMKDVRLPYQLQRVMAAEA 212

  Fly   224 EAMREAKAKVAAAQGERDAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFPFPVDIV 288
            ||.|:|.||:.||:||::|.|||.||||::..:|.|:|||||||||||.::...:.|||||::::
 Worm   213 EATRDAMAKIIAAEGEKNASTALAEAADVISMSPCAIQLRYLQTLNSISSEKNNTIVFPFPMEMM 277

  Fly   289 RNLMK 293
            ...:|
 Worm   278 SRFIK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 71/158 (45%)
SPFH_like 89..292 CDD:302763 94/202 (47%)
sto-6NP_509943.1 PRK11029 37..>98 CDD:182913 34/60 (57%)
SPFH_like 74..275 CDD:388510 95/200 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54926
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - O PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.