DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and sto-5

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001379952.1 Gene:sto-5 / 181730 WormBaseID:WBGene00006067 Length:381 Species:Caenorhabditis elegans


Alignment Length:269 Identity:119/269 - (44%)
Similarity:181/269 - (67%) Gaps:0/269 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LLPQRNVKTSENVPPTCAEKTLFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPR 89
            |:..|::...|..||......:.:.|.:||:|..||.||.|::|:.||:||||.|||||.....:
 Worm   107 LIRTRHLLHEEREPPPLISHMMLIFSFLLILLSFPWCLFFCVKVVKEYQRAVIFRLGRLIKGGTK 171

  Fly    90 GPGVIFLVPCIDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEA 154
            |||:.|::||||.:.:||:|..|||:..||||:||.||:|::.|:|:.:.:|..::..|.|.:.:
 Worm   172 GPGLFFVLPCIDTMKIVDLRVLSFDVPPQEILSRDSVTVSVEAVIYFRVSNPVISVTNVNDAQFS 236

  Fly   155 TEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRAL 219
            |..||.||||||.||..|.::||.::.:::..|.:|...|:|||::|||||||:|.:|.||.|::
 Worm   237 TRLLAQTTLRNVLGTKTLSEMLSERDAIASISEKVLDEGTDPWGVKVERVEIKDIRLPHQLMRSM 301

  Fly   220 AVEQEAMREAKAKVAAAQGERDAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFPFP 284
            |.|.||:|.|:|.:.|||||:||..:|:.|||.:..|.:.:||||||||..|......:.|.|:|
 Worm   302 AAEAEAVRRARAAIIAAQGEKDASESLQTAADTIAQNKMTIQLRYLQTLTKISAQRNNTIVMPYP 366

  Fly   285 VDIVRNLMK 293
            :::.::.||
 Worm   367 IEVAKHYMK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 74/158 (47%)
SPFH_like 89..292 CDD:302763 91/202 (45%)
sto-5NP_001379952.1 SPFH_like 167..368 CDD:418525 91/200 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54926
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.