DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and sto-2

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001257021.1 Gene:sto-2 / 180802 WormBaseID:WBGene00006064 Length:375 Species:Caenorhabditis elegans


Alignment Length:247 Identity:120/247 - (48%)
Similarity:174/247 - (70%) Gaps:0/247 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPRGPGVIFLVPCIDDLAVVDIRT 110
            |..||.|:::...|.|::.|::|:.|||||||.|||||.....:|||:.|::|||:....||:||
 Worm   128 LMGLSWIMVISTFPVSIYFCMKVVQEYERAVIFRLGRLIGGGAKGPGIFFVLPCIESYTKVDLRT 192

  Fly   111 RSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKLMDL 175
            .||.:..|||||:|.||.|:|.|:||.|.:...::..|.:...:|..||.|||||:.||..|.::
 Worm   193 VSFSVPPQEILTKDSVTTSVDAVIYYRISNATVSVANVENAHHSTRLLAQTTLRNMLGTRSLSEI 257

  Fly   176 LSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQGER 240
            ||.:|.|:..::.||..:||.|||:|||||||::.:|.||:||:|.|.||.|||:|||.||:||:
 Worm   258 LSDRETLAASMQTILDEATESWGIKVERVEIKDVRLPIQLQRAMAAEAEATREARAKVIAAEGEQ 322

  Fly   241 DAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFPFPVDIVRNLM 292
            .|..||::||.::..:|.||||||||||||:..:...:.:||.|:::||:|:
 Worm   323 KASRALRDAASVIAQSPAALQLRYLQTLNSVAAEKNSTIIFPLPMELVRHLI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 77/158 (49%)
SPFH_like 89..292 CDD:302763 99/202 (49%)
sto-2NP_001257021.1 PHB 146..298 CDD:214581 73/151 (48%)
SPFH_like 168..368 CDD:302763 97/199 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54926
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.