DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and phb-2

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_495250.2 Gene:phb-2 / 174034 WormBaseID:WBGene00004015 Length:294 Species:Caenorhabditis elegans


Alignment Length:200 Identity:42/200 - (21%)
Similarity:83/200 - (41%) Gaps:26/200 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GVIFLVPCIDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYD------ 150
            |:.|.:|......:.|||.|...: |....::|:..::| |:...|..:| :.::.:|.      
 Worm    66 GLHFRIPWFQYPIIYDIRARPNQI-RSPTGSKDLQMVNI-GLRVLSRPNP-EHLVHIYRTLGQNW 127

  Fly   151 PEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQL 215
            .|.....:....|:.|........|::.::.:|..:...|......:.|.::.|.:.|:....|.
 Worm   128 EERVLPSICNEVLKGVVAKFNASQLITQRQQVSMLVRKTLIERALDFNIILDDVSLTELAFSPQY 192

  Fly   216 KRALAVEQEAMREA--------------KAKVAAAQGERDAVTALKEAADIMETNPIALQLRYLQ 266
            ..|:..:|.|.:||              :.|:..|:||.::...|.||   |:.:|..|:||.::
 Worm   193 SAAVEAKQVAAQEAQRATFYVERAKQQKQEKIVQAEGEAESAKLLGEA---MKNDPGFLKLRKIR 254

  Fly   267 TLNSI 271
            ....|
 Worm   255 AAQKI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 25/136 (18%)
SPFH_like 89..292 CDD:302763 41/199 (21%)
phb-2NP_495250.2 PHB 39..200 CDD:214581 25/136 (18%)
SPFH_prohibitin 40..234 CDD:259799 33/170 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.