Sequence 1: | NP_649445.3 | Gene: | CG14644 / 40536 | FlyBaseID: | FBgn0250821 | Length: | 293 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495250.2 | Gene: | phb-2 / 174034 | WormBaseID: | WBGene00004015 | Length: | 294 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 42/200 - (21%) |
---|---|---|---|
Similarity: | 83/200 - (41%) | Gaps: | 26/200 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 GVIFLVPCIDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYD------ 150
Fly 151 PEEATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQL 215
Fly 216 KRALAVEQEAMREA--------------KAKVAAAQGERDAVTALKEAADIMETNPIALQLRYLQ 266
Fly 267 TLNSI 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14644 | NP_649445.3 | PHB | 64..223 | CDD:214581 | 25/136 (18%) |
SPFH_like | 89..292 | CDD:302763 | 41/199 (21%) | ||
phb-2 | NP_495250.2 | PHB | 39..200 | CDD:214581 | 25/136 (18%) |
SPFH_prohibitin | 40..234 | CDD:259799 | 33/170 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0330 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |