DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and Nphs2

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_570841.3 Gene:Nphs2 / 170672 RGDID:620461 Length:383 Species:Rattus norvegicus


Alignment Length:270 Identity:98/270 - (36%)
Similarity:163/270 - (60%) Gaps:4/270 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ESLLPQRNVKTSENVPPTCAEKTLFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKP 87
            ||..|:..:|.|   .....|..|.:.|:|.|::..|:|::.|::|:.||||.:|.|||.|.|..
  Rat    85 ESERPEEGIKPS---GLGACEWLLVLSSLIFIIVTFPFSIWFCIKVVQEYERVIIFRLGHLLPGR 146

  Fly    88 PRGPGVIFLVPCIDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPE 152
            .:|||:.|.:||:|....||:|.::.::...|::|:||..:.||.|.||.:::....:..:....
  Rat   147 AKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVS 211

  Fly   153 EATEKLAMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKR 217
            :|.:.|..||::.:.....|.::|..::.::..::..|.:.|..|||:|||.|||::.:|..|:.
  Rat   212 KAIQFLVQTTMKRLLAHRSLTEILLERKSIAQDVKVALDSVTCVWGIKVERTEIKDVRLPAGLQH 276

  Fly   218 ALAVEQEAMREAKAKVAAAQGERDAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFP 282
            :||||.||.|:||.:|.||:||:.|..:|:.||:|:...|.|:|||||.||.|:..|...:.|.|
  Rat   277 SLAVEAEAQRQAKVRVIAAEGEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTDKPSTVVLP 341

  Fly   283 FPVDIVRNLM 292
            .|.|:: ||:
  Rat   342 LPFDML-NLL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 53/158 (34%)
SPFH_like 89..292 CDD:302763 73/202 (36%)
Nphs2NP_570841.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..73
SPFH_podocin 122..344 CDD:259809 82/221 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.