DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14644 and nphs2

DIOPT Version :9

Sequence 1:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_017949096.1 Gene:nphs2 / 100498000 XenbaseID:XB-GENE-485101 Length:376 Species:Xenopus tropicalis


Alignment Length:246 Identity:91/246 - (36%)
Similarity:154/246 - (62%) Gaps:0/246 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EKTLFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPRGPGVIFLVPCIDDLAVVD 107
            |..|....::|::|.||.|::.|::|:.|||||||.||||:.....||||:.|.:||:|....||
 Frog    96 EGLLIFCCLLLVILTLPLSIWFCVKVVREYERAVIFRLGRMLSGRARGPGLFFYLPCLDKCHKVD 160

  Fly   108 IRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKLAMTTLRNVAGTHKL 172
            .|.::|::...:|:|:|:||:.||.:.||.:::....:..|.....|.:.|..||.:.:......
 Frog   161 FRLKTFEVPFHQIVTKDLVTLEIDVICYYRLENACLFLTSVSSISSAFQLLVQTTTKRLLAHRAF 225

  Fly   173 MDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQEAMREAKAKVAAAQ 237
            :|:|..::.:..:::..|..:|..|||:|||.|||::.:|:::|:::|||.||.|.||.||.||:
 Frog   226 LDILLERKSIGEEVKVALDAATCHWGIKVERTEIKDVKLPEEVKQSMAVEAEAQRHAKVKVIAAE 290

  Fly   238 GERDAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFPFPVDIV 288
            ||:.....:|.||:.:..:|.|:|||||.||..:.::...::|.|.|.|::
 Frog   291 GEKTVSEYIKLAAEKLSGSPTAIQLRYLHTLQCMTSEKPATFVLPLPFDLM 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14644NP_649445.3 PHB 64..223 CDD:214581 56/158 (35%)
SPFH_like 89..292 CDD:302763 71/200 (36%)
nphs2XP_017949096.1 SPFH_podocin 116..338 CDD:259809 82/221 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.