DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and TwdlT

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_651999.1 Gene:TwdlT / 44790 FlyBaseID:FBgn0029170 Length:286 Species:Drosophila melanogaster


Alignment Length:169 Identity:70/169 - (41%)
Similarity:89/169 - (52%) Gaps:33/169 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LVSKDIYVHVPPAEEPEDRYPQPVLPPAPPRKHYRIVFIKAPTTSVSKAALRIKQAPVEEKTIIY 176
            ||.|.|||||||.|:.|.| .:|.||....:|||:|:|||||:....:|.:...|...||||::|
  Fly   130 LVQKHIYVHVPPPEQEEVR-QRPNLPIGQSQKHYKIIFIKAPSPPSYQAPVIPLQPQNEEKTLVY 193

  Fly   177 VLTKKP-DPLDLQTAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGV 240
            ||.||| |..|:  .|...||.|||||||:|||||||::::...          ||.|       
  Fly   194 VLVKKPEDQQDI--VIPTPAPTQPSKPEVYFIKYKTQKDSSGIS----------GGIS------- 239

  Fly   241 APVTSVIGVLDNQRNNGISS---GQFSG------SLPNS 270
               .|..|.......||.:|   |.|:|      |.|:|
  Fly   240 ---GSTGGFTQTNTGNGYTSGGDGGFTGGDSGSISAPSS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 53/99 (54%)
TwdlTNP_651999.1 DUF243 132..225 CDD:281144 49/95 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.