DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and TwdlC

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_651519.1 Gene:TwdlC / 43245 FlyBaseID:FBgn0039469 Length:360 Species:Drosophila melanogaster


Alignment Length:275 Identity:96/275 - (34%)
Similarity:129/275 - (46%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIVPCLLGLAAGI------PQGYNYQA--QQQLQSSAQAG------QLHLPSIPQ---FATLA-- 49
            |:| |:..|.|..      |..|:|..  |||.|.:....      |::.| :||   ||..|  
  Fly     7 FVV-CVASLVATTLGRPEPPSPYSYHGLPQQQSQRALPLNAHPVPPQIYQP-LPQEQSFANFAPP 69

  Fly    50 EQTILQQALQAPKLQQV---LTGGEGLASYSNQNQASAYQQQATQFGPNSAYNALPQAHQPQQQH 111
            :||.|...:....::||   ....|.|.:| :.:...|::....|..  |.||..|      |:.
  Fly    70 QQTYLPPQMHLDAIEQVAPTAAAAEPLNAY-DDSYNMAHRLSGVQHA--SGYNNGP------QET 125

  Fly   112 LVSKDIYVHVPPAE-EPEDRYPQPV-LPPAPPRKHYRIVFIKAPTTSVSKAALRIKQAPV----E 170
            .|.|.|||||||.: |.||.....| ....|.:|||:|||||||    |..|:|....|.    |
  Fly   126 KVHKHIYVHVPPKDFEEEDAIQTRVHHQQGPKQKHYKIVFIKAP----SAPAIRQPVVPPPPQNE 186

  Fly   171 EKTIIYVLTKKPDPLDLQTAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQV 235
            |||:||||.|||:. :....|....|.:||||||:||||||:::.|.......|:.:    ..|.
  Fly   187 EKTLIYVLHKKPEQ-EQDIVIPTPPPTKPSKPEVYFIKYKTKKDEAPVYGPPPAEME----PRQA 246

  Fly   236 SDEGVAPVTSVIGVL 250
            :.|..||:..|..||
  Fly   247 TAEDFAPLAEVADVL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 52/104 (50%)
TwdlCNP_651519.1 DUF243 125..227 CDD:299795 52/106 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.