DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and TwdlQ

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_651496.1 Gene:TwdlQ / 43214 FlyBaseID:FBgn0039448 Length:245 Species:Drosophila melanogaster


Alignment Length:287 Identity:93/287 - (32%)
Similarity:131/287 - (45%) Gaps:57/287 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFFIVPCLLGLAAGIPQGYNYQAQQQLQSSAQAGQLHLPSIPQFATL--AEQTILQQALQAPKL 63
            |..|::..|:...:....|||||        |.||.      .:||.|  ||.|           
  Fly     1 MRGFLLLLLIASVSAAKLGYNYQ--------AAAGD------RRFAGLIDAEAT----------- 40

  Fly    64 QQVLTGGEGLASYSNQNQASAYQQQATQFGPNSAYNALPQAHQPQQ----QHLVSKDIYVHVPPA 124
                    |.:|.|.|.|   .||||.|        .|.|.:..||    ....||:.|.:..|.
  Fly    41 --------GFSSTSTQQQ---QQQQAQQ--------ELVQQNTQQQIPAAADEFSKEFYTYAAPE 86

  Fly   125 EEPEDRYPQPVLPPAPPRKHYRIVFIKAPT-TSVSKAALRIKQAPVEEKTIIYVLTKKPDPLDLQ 188
            ||..|:.....: .:..:::.|::|||:|. ..::.|||::.:...|::|.||||:|:.|...|.
  Fly    87 EEFADQEATEHI-ASMLKRNLRVLFIKSPEHQGLTNAALQLAKQASEQRTAIYVLSKQADVSQLA 150

  Fly   189 TAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGVAPV---TSVIGVL 250
            ..:......|..||||.|:||:|.|:|..||:.||.|:|.|||:|:.||||||||   :|....:
  Fly   151 QRLANENQAQSPKPEVHFVKYRTPEDAVRAQQLIQQQFDSLGGSSRSSDEGVAPVLDFSSAPAAI 215

  Fly   251 DNQRNNGISSGQFSGSLP-NSYLPTNL 276
            ..|..|. :..|.....| ..|||..|
  Fly   216 SVQEQNE-AQNQVQAVTPLTKYLPAAL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 32/99 (32%)
TwdlQNP_651496.1 DM5 73..174 CDD:214776 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443929
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.