DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and TwdlD

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_651492.1 Gene:TwdlD / 43210 FlyBaseID:FBgn0039444 Length:256 Species:Drosophila melanogaster


Alignment Length:296 Identity:85/296 - (28%)
Similarity:135/296 - (45%) Gaps:73/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFFIVPCLLGLAAGIPQ-GYNYQ----AQQQLQSSAQAGQL--HLPS--IPQFATLAEQTILQQ 56
            |..|||.|||.::....: |||||    |.:.|.....:||:  .|||  :|   ..:.:.:|.|
  Fly     1 MRAFIVLCLLAVSCSADKLGYNYQPVAHADEGLSFLPGSGQVIGELPSQVLP---VQSGEAVLSQ 62

  Fly    57 ALQAPKLQQVLTGGEGLASYSNQNQASAYQQQATQFGPNSAYNALPQAHQPQQQHLVSKDIYVHV 121
            .::||...|:                                  .|...:.|      |:.|.:.
  Fly    63 PIEAPVAPQI----------------------------------APLVEEFQ------KEFYSYA 87

  Fly   122 PPAEEPEDRYPQPVLPPAPPRKHYRIVFIKAP-TTSVSKAALRIKQAPVEEKTIIYVLTKKPDPL 185
            .|.|:.::......:..: .:|:.|:|||:.| .....:|||::.:...:::|.||||||:.|..
  Fly    88 APEEQYDEGASNQQIANS-LKKNLRVVFIRTPENQGFERAALQLAKQSAQQETAIYVLTKQSDVS 151

  Fly   186 DLQTAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGVAPVTSVIGVL 250
            :|...:..:.....:||||.|:||:|.|:||:||..||.||:||.|.|::|:||.|||.      
  Fly   152 NLAKQLNALKTSSTNKPEVHFVKYRTPEDAANAQLAIQNQYNQLPGVSRISNEGRAPVL------ 210

  Fly   251 DNQRNNGISSGQFSGSLP--------NSYLPTNLRA 278
                 |..||...:.::|        :.|||.|:.|
  Fly   211 -----NFASSPAQAAAIPAVAAAAPSSEYLPANVVA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 29/99 (29%)
TwdlDNP_651492.1 DM5 78..178 CDD:214776 30/106 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.