DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and TwdlN

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster


Alignment Length:322 Identity:95/322 - (29%)
Similarity:136/322 - (42%) Gaps:67/322 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFFIVPCLLGLAAGIPQGYNYQ-------------------------------AQQQLQSSAQA 34
            |..|:|.||:.:|:....||||:                               :...|.....:
  Fly     1 MRAFVVLCLVAIASADKLGYNYKPVGHSSSGLSFAPGSGSLSLGGGGGSLGLGGSSGSLDLGGAS 65

  Fly    35 GQLHLPSIPQFATL---------AEQTILQQALQAPKLQQVLTGGEGLASYSNQNQASAYQQQAT 90
            |.|.|.....|.:|         ....:....|.:..|...| |..||.|....:...:....|.
  Fly    66 GSLGLGGGSNFGSLDGGFGGLGGGSIDLGSSGLGSSGLGSGL-GSSGLGSGLGSSGLGSGLGSAG 129

  Fly    91 QFGPNSAYNALPQAHQPQQQHLVSKDIYVHVPPAEEPEDRYPQPVLPPAPP-RKHYRIVFIKAP- 153
            ...|.| |||...|.:.|      |:.:.:.  |.|.:...||.:...|.. .|..|:||||.| 
  Fly   130 LSAPVS-YNAPAPAAELQ------KEFFTYT--ANEEDFDEPQALERVASSVNKGLRVVFIKGPE 185

  Fly   154 TTSVSKAALRIKQAPVEEKTIIYVLTKKPDPLDLQTAIEEIAPKQPSKPEVFFIKYKTQEEAAHA 218
            ...:..|||.:.:...:::|.||||.|:.|..||...:..|.....:||||.|:||:|.|:||:|
  Fly   186 NRGLENAALALAKQAAQQETAIYVLNKQADIGDLAQKLNAIRSNSNNKPEVHFVKYRTPEDAANA 250

  Fly   219 QRTIQAQYDQLGGTSQVSDEGVAPVTSVIGVLDNQRNNGISSG---QFSGSLP-NSYLPTNL 276
            ||.||:|||||||:||..:.|||...           |..|:|   |.:..:| |||||:::
  Fly   251 QRAIQSQYDQLGGSSQAINGGVANAL-----------NFASAGPVRQATAQIPENSYLPSSV 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 33/100 (33%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 34/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.