DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and TwdlO

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_651487.1 Gene:TwdlO / 43204 FlyBaseID:FBgn0039438 Length:229 Species:Drosophila melanogaster


Alignment Length:287 Identity:81/287 - (28%)
Similarity:113/287 - (39%) Gaps:76/287 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFFIVPCLLGLAAGIPQGYNYQAQQQLQSSAQAGQLHLPSIPQFATLAEQTILQQALQAPKLQQ 65
            |.|.|..||:|.|..   .|||.|.                                        
  Fly     1 MRFLIAFCLIGAACA---QYNYGAG---------------------------------------- 22

  Fly    66 VLTG--GEGLASYSNQNQASAYQQQAT--QFGPNSAYNALPQAHQPQQQHLVSKDIYVHVPPAEE 126
             .||  .:.:.|||..:...:|...|:  .:..:|..|               |:.|..    |.
  Fly    23 -FTGAASDNVPSYSGSSVGDSYDGAASSPDYSVSSELN---------------KEYYTF----EA 67

  Fly   127 PEDRYPQPVLP---PAPPRKHYRIVFIKAP-TTSVSKAALRIKQAPVEEKTIIYVLTKKPDPLDL 187
            .|.::..|:..   .....|..|:||||.| ...:..|||.:.:...|::|.||||.|:.|..||
  Fly    68 DESQFEDPLAAQKIAGSVNKGLRVVFIKGPENRGLENAALALAKQAAEQRTAIYVLNKQTDIGDL 132

  Fly   188 QTAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGVAPV---TSVIGV 249
            .............:|||.|:||:|.|:||:|||.||:|||.|||:||..:.|||..   .|...|
  Fly   133 AQKFNAARQNSNQRPEVHFVKYRTPEDAANAQRAIQSQYDNLGGSSQSINGGVANAINFASAAPV 197

  Fly   250 LDNQRNNGISSGQFSGSLPNSYLPTNL 276
            :..:|....|..  :.:..|||||.|:
  Fly   198 VPARRGPNYSPP--AAATSNSYLPANI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 31/102 (30%)
TwdlONP_651487.1 DM5 56..157 CDD:214776 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.