DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and TwdlB

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_651486.1 Gene:TwdlB / 43202 FlyBaseID:FBgn0039436 Length:286 Species:Drosophila melanogaster


Alignment Length:307 Identity:93/307 - (30%)
Similarity:134/307 - (43%) Gaps:58/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFFIVPCLLGLAAGIPQGYNYQ----AQQQLQSSAQAGQLHLPSIPQFATLAEQTI-------- 53
            |..|||.||:.:......|||||    :...|..:..:|.:...||.. .::...:|        
  Fly     1 MRAFIVLCLVAVTCADKLGYNYQPVGHSSSGLSFAPGSGSISGGSIGG-GSIGGGSIGGGSIGGG 64

  Fly    54 ----------------LQQALQAPKLQQVLTGGEGLASYSNQNQASAYQQQATQFGPNSAYNALP 102
                            |..::....:...|.|..||......:..:|         |.| |||..
  Fly    65 LIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAA---------PVS-YNAPA 119

  Fly   103 QAHQPQQQHLVSKDIYVHVPPAEEPEDRYPQPVLPPA-PPRKHYRIVFIKAP-TTSVSKAALRIK 165
            .|.:.|      |:.:.:  .|.|.:...||.:...| ...|..|:||||.| ...:..|||.:.
  Fly   120 PAAELQ------KEFFTY--SANEQDFDEPQELERVAGSVNKGLRVVFIKGPENRGLENAALALA 176

  Fly   166 QAPVEEKTIIYVLTKKPDPLDLQTAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLG 230
            :...:::|.||||.|:.|..||...:..|.....:||||.|:||:|.|:||:|||.||.||||||
  Fly   177 KQAAQQETAIYVLNKQADIGDLAQKLNAIRNNNNNKPEVHFVKYRTPEDAANAQRAIQGQYDQLG 241

  Fly   231 GTSQVSDEGVAPVTSVIGVLDNQRNNGISSGQFSGSLP-NSYLPTNL 276
            |:||..|.||||..:.......|:.|        ..:| |:||||::
  Fly   242 GSSQAHDGGVAPALNFASAGPVQKAN--------AQIPDNAYLPTSV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 33/100 (33%)
TwdlBNP_651486.1 DM5 122..223 CDD:214776 34/108 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.