DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and TwdlW

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_650606.2 Gene:TwdlW / 42075 FlyBaseID:FBgn0038487 Length:308 Species:Drosophila melanogaster


Alignment Length:326 Identity:111/326 - (34%)
Similarity:152/326 - (46%) Gaps:71/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFFIVPCLLGLAAGIPQ--------GYNYQAQQQLQSSAQAGQLHLPSIPQFATLAEQTILQQA 57
            |..|:...:..:...:.|        ||||:.|||.|........||        |.:|...||.
  Fly     1 MKIFVTVLMGAMCLSLSQADISLTQAGYNYRIQQQQQQQQPPIVAHL--------LNQQLQQQQQ 57

  Fly    58 LQ--------------------------APKLQQVLTGGEGLASYSNQNQASAYQQQATQFGPNS 96
            ||                          .|.::.........|.:....|.:..|||.       
  Fly    58 LQPQQSSHPVLPPLPLPYLPPAGQFHSAQPAVRPTAGSFPMPAGFPVNFQTAPIQQQR------- 115

  Fly    97 AYNALPQAHQPQQQHLVSKDIYVHVPPAEEPEDRYPQPVLPPA-PPRKHYRIVFIKAPTTSVSKA 160
              .|.|:...|::. :|:|:.::|..| ||.||.....:...| .||.||.::|:|.|..:...|
  Fly   116 --RARPRVRIPKRP-IVTKNFFIHSAP-EESEDEVQDELNQLAQQPRNHYNVLFVKTPAQTNRAA 176

  Fly   161 ALRIKQAPVEEKTIIYVLTKKPDPLDLQTAIEEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQ 225
            ||.:.:...:|||::|||.||....|||.||.| ||:..:|||||||||:|.|||.:|||.||:|
  Fly   177 ALNLAKTLKQEKTVVYVLAKKTTASDLQDAIAE-APQHINKPEVFFIKYRTPEEALNAQRQIQSQ 240

  Fly   226 YDQLGGTSQVSDEGVAPVTSVIGVLD-------NQRNNGISSGQFS---------GSLPNSYLPT 274
            ||.|||:|.::||||||:|||:|.||       .|:....|.|||:         |.:.|.|||.
  Fly   241 YDTLGGSSTITDEGVAPITSVVGSLDPPEEEEEEQQQQQHSEGQFAENGAGNSGVGPIGNHYLPA 305

  Fly   275 N 275
            |
  Fly   306 N 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 44/99 (44%)
TwdlWNP_650606.2 DM5 127..227 CDD:214776 44/102 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443730
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8V1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2679
65.840

Return to query results.
Submit another query.