DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and TwdlV

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_649446.1 Gene:TwdlV / 40537 FlyBaseID:FBgn0037227 Length:251 Species:Drosophila melanogaster


Alignment Length:293 Identity:114/293 - (38%)
Similarity:148/293 - (50%) Gaps:61/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFFIVPCLLGLAAGIPQGYNYQAQQQLQSSAQAGQLHLPSIPQFATLAEQT----ILQQALQAP 61
            |..|||.||..:|...||||||.                |....|..::..|    ..|.|:|..
  Fly     1 MSGFIVLCLCSVALAAPQGYNYN----------------PGPSGFGGISTTTGGGSFFQGAVQVA 49

  Fly    62 KLQQVLTGGEGLASYSNQNQASAYQQQATQFGPNSAYNALPQAHQPQQQHLVSKDIYVHVPPAEE 126
            .:|                ..:.|||.|.|...:.      |....|||.:|||..::|..| ||
  Fly    50 PVQ----------------PQAVYQQPAAQTHHHQ------QQQVQQQQAIVSKRFFIHSAP-EE 91

  Fly   127 PEDRYPQPVLPPAPPRKHYRIVFIKAPTTSVSKAALRIKQAPVEEKTIIYVLTKKPDPLDLQTAI 191
            .|| |.:..:....|:::|.:||||:|..: ::..::|..|..||||:||||:||.:. ||...:
  Fly    92 AED-YKERHITVGVPKRNYNVVFIKSPQRN-NRKTIKISPAANEEKTVIYVLSKKGES-DLNAEV 153

  Fly   192 EEIAPKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGVAPVTSVIGVL---DNQ 253
            .|.| ...||||||||||||.|||||||:.||||||.|||:||::||||||||||||.|   |..
  Fly   154 VEQA-SSTSKPEVFFIKYKTNEEAAHAQQQIQAQYDALGGSSQLTDEGVAPVTSVIGALGGSDGH 217

  Fly   254 RNNG-----------ISSGQFSGSLPNSYLPTN 275
            .:.|           :|:|.......|:|||.|
  Fly   218 IDGGSVVGATGAGQIVSTGTAGSHTGNAYLPPN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 44/98 (45%)
TwdlVNP_649446.1 DM5 78..173 CDD:214776 44/99 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443748
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8V1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2679
65.840

Return to query results.
Submit another query.