DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and TwdlF

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster


Alignment Length:309 Identity:123/309 - (39%)
Similarity:160/309 - (51%) Gaps:53/309 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FFIVPCLLGLAAGIPQGYNYQAQ------------QQLQSSAQAGQLHLPSIPQF---------- 45
            |.::.||:.|.|..||||.||.|            ..:.||.......:||.||.          
  Fly     4 FVVLMCLVALTATAPQGYKYQPQLPALPIGNLRPLTPISSSGIYASGAVPSFPQAGAQPAIGVQP 68

  Fly    46 ATLAEQTILQQALQAP---KLQQVLTGGEGLASYSNQNQASAYQQQATQFGPNSAYNALP-QAHQ 106
            |..|.|||:.....||   .|...|.....|.:...||..|..|||..|.    .|...| ||.|
  Fly    69 AIQAVQTIVAAPAPAPAPAPLSISLPKETFLTASPQQNLISTVQQQPQQI----VYQQQPQQALQ 129

  Fly   107 P---QQQHLVSKDIYVHVPPAEEPEDRYPQPVLPPAPPRKHYRIVFIKAPTTSV--SKAALRIKQ 166
            .   |:..:|:||||:|..|.|..|.|..:|:|...|.||:|||||||||:.::  :.|||:..|
  Fly   130 TQFVQRPAIVTKDIYIHSAPEENEELRQDEPLLENVPIRKNYRIVFIKAPSQNLKYTAAALKRAQ 194

  Fly   167 APVEEKTIIYVLTKKPDPLDLQTAIEEI-APKQPSKPEVFFIKYKTQEEAAHAQRTIQAQYDQLG 230
            :..||||:||||:||||..::|..::.. :..:..||||:||||||||||..||:.||||||.||
  Fly   195 SSNEEKTVIYVLSKKPDLTEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQAQYDALG 259

  Fly   231 GTSQVSDEGVAPVTSVIGVLDNQRNNGISSGQFSGSLP-NSYLPTNLRA 278
            |.:.:|||||||:.||                .||||. .|::|.:.:|
  Fly   260 GATHISDEGVAPIASV----------------SSGSLNLGSFVPQHSQA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 50/101 (50%)
TwdlFNP_649443.1 DM5 137..241 CDD:214776 50/103 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443756
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8V1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2679
65.840

Return to query results.
Submit another query.