DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and Twdlbeta

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_610707.2 Gene:Twdlbeta / 36265 FlyBaseID:FBgn0033658 Length:198 Species:Drosophila melanogaster


Alignment Length:131 Identity:60/131 - (45%)
Similarity:80/131 - (61%) Gaps:24/131 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 FGPNSAYNALPQAHQPQQQHLVSKDIYVHVPPAEEPEDRYP--QPVLPPAPPRKHYRIVFIKAPT 154
            :||.:|:...|.|    .:.||:|::|||||| |||| .||  .|: ..|.|:|||:|:|||||.
  Fly    53 YGPPAAFYGPPAA----SEALVTKNVYVHVPP-EEPE-FYPASSPI-QTAVPKKHYKIIFIKAPN 110

  Fly   155 --TSVSKAALRIKQAPV--EEKTIIYVLTKKPD---PLDLQTAIEEIAPKQPSKPEVFFIKYKTQ 212
              |.|.    ::...||  |.||::|||.|||:   |:.|...    .|.:||||||:|||||.|
  Fly   111 PPTPVR----QVLPPPVQDEHKTLVYVLVKKPEEQQPVILPAP----EPTEPSKPEVYFIKYKQQ 167

  Fly   213 E 213
            :
  Fly   168 Q 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 53/107 (50%)
TwdlbetaNP_610707.2 DM5 68..167 CDD:214776 54/109 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.