DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and TwdlE

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster


Alignment Length:142 Identity:71/142 - (50%)
Similarity:90/142 - (63%) Gaps:10/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SYSNQNQASAYQQQATQFGPNSAYNA-LPQAHQPQQQHLVSKDIYVHVPPAEEPEDRYPQPVLPP 138
            ||| ...:|:||..    ||:..|.| .||...|||..::.|.:|||||| .|||.:.|:..|..
  Fly    27 SYS-APPSSSYQPS----GPSGGYGAPAPQYGPPQQAPVIHKHVYVHVPP-PEPEYQAPRKPLYV 85

  Fly   139 APPRKHYRIVFIKAPTTSVSKAALRIKQAPV-EEKTIIYVLTKKPDPLDLQTAIEEIAPKQPSKP 202
            .||:|||:|||||||:..|..|.: |.|.|. ||||::|||.|||:. ..:..|...||.|||||
  Fly    86 PPPQKHYKIVFIKAPSPPVPTAPV-IPQFPQNEEKTLVYVLVKKPEE-QPEIIIPTPAPTQPSKP 148

  Fly   203 EVFFIKYKTQEE 214
            ||:||:||||:|
  Fly   149 EVYFIRYKTQKE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 53/99 (54%)
TwdlENP_609157.3 DM5 59..158 CDD:214776 53/101 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.