DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlG and Twdlalpha

DIOPT Version :9

Sequence 1:NP_001262245.1 Gene:TwdlG / 40535 FlyBaseID:FBgn0037225 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_728020.1 Gene:Twdlalpha / 326223 FlyBaseID:FBgn0052574 Length:388 Species:Drosophila melanogaster


Alignment Length:357 Identity:120/357 - (33%)
Similarity:156/357 - (43%) Gaps:83/357 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFFIVPC-LLGLAAGIPQGYNYQA--QQQLQSSAQAGQ-----LHLPSIPQFATLAEQTILQQA 57
            |..|:..| ||.|:...||||||.:  ...|.:|..:|.     |..||....|:.......|.|
  Fly     1 MRLFVTLCSLLVLSQAKPQGYNYGSGVSGSLTTSGSSGGSSGGFLTAPSHSSVASYGPLGAFQTA 65

  Fly    58 --------LQAPKLQQVLTGGEGL--------------------ASYSNQNQASAYQ-------- 86
                    ..||.......||.|.                    |:||.....:.|.        
  Fly    66 SVGSLVGSSSAPHSVSHYGGGNGATYTTGGGNGHAATYSTGGHGATYSTGGNGATYSTGGSSNYG 130

  Fly    87 -QQATQFG--PNSAYNAL-----PQAHQPQQQH--------LVSKDIYVHVPPAEEPEDRYPQPV 135
             ...|.||  ||..:.||     |...|.|:|.        ::.|..:....| ||.|:......
  Fly   131 GSSFTGFGPTPNIGFGALAGYQAPTYQQQQEQEVQRGFQEPIIHKQFFTVAAP-EEHENLERSKH 194

  Fly   136 LPPAPPRKHYRIVFIKAPTTSVSKAALRIKQAPVEEKTIIYVLTKKPDPLDLQTAIEEIAPKQPS 200
            |....|:|:||:||||||::|.:...|..:.||.||||:||||:||.:.|::.. |...||..||
  Fly   195 LVIGRPQKNYRVVFIKAPSSSNANVKLSAEYAPKEEKTVIYVLSKKDNQLEVND-IATPAPTVPS 258

  Fly   201 KPEVFFIKYKTQEEAAHAQRTIQAQYDQLGGTSQVSDEGVAPVTSVIGVLDNQRNNGISSGQF-- 263
            |||||||||||..||:|||:.|||:||::.|||:..|.||||..||:|:||.......|||..  
  Fly   259 KPEVFFIKYKTDAEASHAQQQIQAEYDRIEGTSEHQDGGVAPAQSVVGILDGGAIGAASSGSSNY 323

  Fly   264 -------------------SGSLPNSYLPTNL 276
                               :||...||..|:|
  Fly   324 VSGGTTGSTGGTSHYVSGGTGSTGGSYTTTSL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlGNP_001262245.1 DM5 113..212 CDD:214776 46/98 (47%)
TwdlalphaNP_728020.1 DM5 171..270 CDD:214776 46/100 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443746
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2679
54.940

Return to query results.
Submit another query.