DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlF and TwdlS

DIOPT Version :9

Sequence 1:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_651491.1 Gene:TwdlS / 43209 FlyBaseID:FBgn0039443 Length:228 Species:Drosophila melanogaster


Alignment Length:121 Identity:33/121 - (27%)
Similarity:65/121 - (53%) Gaps:8/121 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DIYIHSAPEENEELR--QDEPLLENVPIRKNYRIVFIKAPSQNLKYTAAALKRAQSSNEEKTVIY 204
            :.:.::||.|::::.  |....|..| :....::|||:.|..|: :|..|.:.|.::..:   |:
  Fly    50 EYFTYAAPPEDDQVAPWQSARELAKV-LSPPQQVVFIRTPETNI-FTLTAKQLAVNNPLD---IF 109

  Fly   205 VLSKKPDLTEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQAQYDALGG 260
            ||.::.|...:.:|....|.:.. :||.|:|:||:|..:..||...:::.||.|.|
  Fly   110 VLHRQADADALAKQQAAIQQQVS-EKPSVHFVKYRTPADVTRALSALRSDYDRLPG 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlFNP_649443.1 DM5 137..241 CDD:214776 26/100 (26%)
TwdlSNP_651491.1 DM5 45..145 CDD:214776 26/100 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443950
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.