DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlF and TwdlN

DIOPT Version :9

Sequence 1:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_733160.1 Gene:TwdlN / 43207 FlyBaseID:FBgn0039441 Length:309 Species:Drosophila melanogaster


Alignment Length:362 Identity:93/362 - (25%)
Similarity:143/362 - (39%) Gaps:118/362 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQFVVLMCLVALTATAPQGYKYQP------------------------------QLPALPIG-- 33
            |:.|||| ||||:.:....||.|:|                              ...:|.:|  
  Fly     1 MRAFVVL-CLVAIASADKLGYNYKPVGHSSSGLSFAPGSGSLSLGGGGGSLGLGGSSGSLDLGGA 64

  Fly    34 ----------NLRPL-----------TPISSSGIYASGAVPSFPQAGAQPAIGVQPAIQAVQTI- 76
                      |...|           ..:.|||:.:||.......:|....:|.......:.:. 
  Fly    65 SGSLGLGGGSNFGSLDGGFGGLGGGSIDLGSSGLGSSGLGSGLGSSGLGSGLGSSGLGSGLGSAG 129

  Fly    77 VAAPAPAPAPAPLSISLPKETFLTASPQQNLISTVQQQPQQIVYQQQPQQALQTQFVQRPAIVTK 141
            ::||....||||                                               .|.:.|
  Fly   130 LSAPVSYNAPAP-----------------------------------------------AAELQK 147

  Fly   142 DIYIHSAPEENEELRQDEP-LLENV--PIRKNYRIVFIKAPSQNLKYTAAALKRAQSSNEEKTVI 203
            :.:.::|.||:    .||| .||.|  .:.|..|:||||.| :|.....|||..|:.:.:::|.|
  Fly   148 EFFTYTANEED----FDEPQALERVASSVNKGLRVVFIKGP-ENRGLENAALALAKQAAQQETAI 207

  Fly   204 YVLSKKPDLTEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQAQYDALGGATHISDEG 268
            |||:|:.|:.::.|:|...:|.:. .||||:|:||:|.|:|..||:.||:|||.|||::...:.|
  Fly   208 YVLNKQADIGDLAQKLNAIRSNSN-NKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAINGG 271

  Fly   269 VAPIASVSSGSLNLGSFVPQHSQAGQTIIHSQAPTII 305
            ||       .:||..|..|......|...:|..|:.:
  Fly   272 VA-------NALNFASAGPVRQATAQIPENSYLPSSV 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlFNP_649443.1 DM5 137..241 CDD:214776 40/106 (38%)
TwdlNNP_733160.1 DM5 143..244 CDD:214776 40/106 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.