DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlF and TwdlL

DIOPT Version :9

Sequence 1:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_733158.1 Gene:TwdlL / 43203 FlyBaseID:FBgn0039437 Length:285 Species:Drosophila melanogaster


Alignment Length:353 Identity:90/353 - (25%)
Similarity:139/353 - (39%) Gaps:121/353 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQFVVLMCLVALTATAPQGYKYQPQLPALPIGNLRPLTPISSSGI------------------- 46
            |:.|:| |||||:......||.||      |:|:       ||||:                   
  Fly     1 MRAFIV-MCLVAVACADKLGYNYQ------PVGH-------SSSGLSFAPGSGSIGGGSIGGGSI 51

  Fly    47 -------------------YASGAVPSFPQAGAQPAIGVQPAIQAVQTI--------VAAPAPAP 84
                               ...|::......|:.....:...:..:..:        :|||....
  Fly    52 GGGSIGGGSIGGGLIGGGSIGGGSIGGGSLGGSIGGGSIDSGLGGLGGLGGLGGGDALAAPVSYN 116

  Fly    85 APAPLSISLPKETFLTASPQQNLISTVQQQPQQIVYQQQPQQALQTQFVQRPAIVTKDIYIHSAP 149
            |||| :..|.||.|..::.:|:.              .:||:                       
  Fly   117 APAP-AAELQKEFFTYSANEQDF--------------DEPQE----------------------- 143

  Fly   150 EENEELRQDEPLLENV--PIRKNYRIVFIKAPSQNLKYTAAALKRAQSSNEEKTVIYVLSKKPDL 212
                        ||.|  .:.|..|:||||.| :|.....|||..|:.:.:::|.||||:|:.|:
  Fly   144 ------------LERVAGSVNKGLRVVFIKGP-ENRGLENAALALAKQAAQQETAIYVLNKQADI 195

  Fly   213 TEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQAQYDALGGATHISDEGVAPIASVSS 277
            .::.|:|...::... .||||:|:||:|.|:|..||:.||:|||.|||::...:.||||      
  Fly   196 GDLAQKLNAIRNNNN-NKPEVHFVKYRTPEDAANAQRAIQSQYDQLGGSSQAHNGGVAP------ 253

  Fly   278 GSLNLGSFVPQHSQAGQTIIHSQAPTII 305
             :||..|..|......|...::..||.|
  Fly   254 -ALNFASAGPVQKANAQIPENAYLPTSI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlFNP_649443.1 DM5 137..241 CDD:214776 31/105 (30%)
TwdlLNP_733158.1 DM5 122..223 CDD:214776 38/151 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.