DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlF and TwdlM

DIOPT Version :9

Sequence 1:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_651484.1 Gene:TwdlM / 43200 FlyBaseID:FBgn0039434 Length:288 Species:Drosophila melanogaster


Alignment Length:358 Identity:96/358 - (26%)
Similarity:145/358 - (40%) Gaps:127/358 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQFVVLMCLVALTATAPQGYKYQPQLPALPIGNLRPLTPISSSGI-YASG-------------- 50
            |:.|:| |||||:......||.||      |:|:       ||||: :|.|              
  Fly     1 MRAFIV-MCLVAVACADKLGYNYQ------PVGH-------SSSGLSFAPGSGSIGGGSIGGGSI 51

  Fly    51 -------------------------------AVPSFPQAGAQPAIGVQPAIQAVQTI-----VAA 79
                                           ::.|....|...:|| ..:|.::.:|     ::|
  Fly    52 GGGSIGGGSIGGGSIGGGSIGGSIGGGSIGASIGSGAGLGGLSSIG-GGSIGSIGSIGGGDALSA 115

  Fly    80 PAPAPAPAPLSISLPKETFLTASPQQNLISTVQQQPQQIVYQQQPQQALQTQFVQRPAIVTKDIY 144
            |....|||| :..|.||.|...:.:|:.              .:|||                  
  Fly   116 PVSYNAPAP-TAELEKEFFTFTANEQDF--------------DEPQQ------------------ 147

  Fly   145 IHSAPEENEELRQDEPLLENV--PIRKNYRIVFIKAPSQNLKYTAAALKRAQSSNEEKTVIYVLS 207
                             ||.|  .:.|..|:||||.| :|.....|||..|:.:.:::|.||||:
  Fly   148 -----------------LERVSSALNKALRVVFIKGP-ENRGLENAALALAKQAAQQETAIYVLN 194

  Fly   208 KKPDLTEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQAQYDALGGATHISDEGVAPI 272
            |:.|:.::..:|...:|... .||||:|:||:|.|:|..||:.||.|||.|||::...:.||||:
  Fly   195 KQADIGDLANKLNAIRSNNN-NKPEVHFVKYRTPEDAANAQRAIQGQYDQLGGSSQAHNGGVAPV 258

  Fly   273 ASVSSGSLNLGSFVPQHSQAGQTIIHSQAPTII 305
                   ||..|..|....|.|:..:|..|:.:
  Fly   259 -------LNFASAAPVRQAAAQSPDNSYLPSSV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlFNP_649443.1 DM5 137..241 CDD:214776 31/105 (30%)
TwdlMNP_651484.1 DM5 126..227 CDD:214776 39/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443917
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.