DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlF and TwdlW

DIOPT Version :9

Sequence 1:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_650606.2 Gene:TwdlW / 42075 FlyBaseID:FBgn0038487 Length:308 Species:Drosophila melanogaster


Alignment Length:384 Identity:124/384 - (32%)
Similarity:177/384 - (46%) Gaps:106/384 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQFVVL----MCL------VALTATAPQGYKY------QPQLPALPIGNL--------RPLTPI 41
            ||.||.:    |||      ::||..   ||.|      |.|.|.: :.:|        :.|.|.
  Fly     1 MKIFVTVLMGAMCLSLSQADISLTQA---GYNYRIQQQQQQQQPPI-VAHLLNQQLQQQQQLQPQ 61

  Fly    42 SSS-GIYASGAVPSFPQAG----AQPAIGVQPAIQAVQTIVAAPAPAPAPAPLSISLPKETFLTA 101
            .|| .:.....:|..|.||    ||||  |:|        .|...|.||..|::       |.||
  Fly    62 QSSHPVLPPLPLPYLPPAGQFHSAQPA--VRP--------TAGSFPMPAGFPVN-------FQTA 109

  Fly   102 SPQQNLISTVQQQPQQIVYQQQPQQALQTQFVQRPAIVTKDIYIHSAPEENEELRQDE-PLLENV 165
            .                 .|||.:...:.:..:|| ||||:.:|||||||:|:..||| ..|...
  Fly   110 P-----------------IQQQRRARPRVRIPKRP-IVTKNFFIHSAPEESEDEVQDELNQLAQQ 156

  Fly   166 PIRKNYRIVFIKAPSQNLKYTAAALKRAQSSNEEKTVIYVLSKKPDLTEIQQQLQVTQSEAKVQK 230
            | |.:|.::|:|.|:|..:  ||||..|::..:||||:|||:||...:::|.  .:.::...:.|
  Fly   157 P-RNHYNVLFVKTPAQTNR--AAALNLAKTLKQEKTVVYVLAKKTTASDLQD--AIAEAPQHINK 216

  Fly   231 PEVYFIKYKTQEEAQRAQQEIQAQYDALGGATHISDEGVAPIASVSSGSLNLGSFVPQHSQAGQT 295
            |||:||||:|.|||..||::||:|||.|||::.|:|||||||.||      :||..|...:..: 
  Fly   217 PEVFFIKYRTPEEALNAQRQIQSQYDTLGGSSTITDEGVAPITSV------VGSLDPPEEEEEE- 274

  Fly   296 IIHSQAPTIIQPQGQPIVQLQSINQGVQGVQQQSSFVQKSTSSFAPSAPSRKYVPAKTF 354
                      |.|.|               ..:..|.:....:.........|:||..|
  Fly   275 ----------QQQQQ---------------HSEGQFAENGAGNSGVGPIGNHYLPANQF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlFNP_649443.1 DM5 137..241 CDD:214776 46/104 (44%)
TwdlWNP_650606.2 DM5 127..227 CDD:214776 47/105 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443751
Domainoid 1 1.000 72 1.000 Domainoid score I16253
eggNOG 1 0.900 - - E1_2F8V1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2679
76.840

Return to query results.
Submit another query.