DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlF and TwdlV

DIOPT Version :9

Sequence 1:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_649446.1 Gene:TwdlV / 40537 FlyBaseID:FBgn0037227 Length:251 Species:Drosophila melanogaster


Alignment Length:302 Identity:114/302 - (37%)
Similarity:149/302 - (49%) Gaps:75/302 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKQFVVLMCLVALTATAPQGYKYQPQLPALPIGNLRPLTPISSSGIYASGAVPSFPQAGAQPAIG 65
            |..|:|| ||.::...|||||.|.|             .|....||..:....||.|...|.| .
  Fly     1 MSGFIVL-CLCSVALAAPQGYNYNP-------------GPSGFGGISTTTGGGSFFQGAVQVA-P 50

  Fly    66 VQPAIQAVQTIVAAPAPAPAPAPLSISLPKETFLTASPQQNLISTVQQQPQQIVYQQQPQQALQT 130
            |||                                        ..|.|||....:..|.||..|.
  Fly    51 VQP----------------------------------------QAVYQQPAAQTHHHQQQQVQQQ 75

  Fly   131 QFVQRPAIVTKDIYIHSAPEENEELRQDEPLLENVPIRKNYRIVFIKAPSQNLKYTAAALKRAQS 195
            |     |||:|..:|||||||.|:.: :..:...|| ::||.:||||:|.:|.:.|   :|.:.:
  Fly    76 Q-----AIVSKRFFIHSAPEEAEDYK-ERHITVGVP-KRNYNVVFIKSPQRNNRKT---IKISPA 130

  Fly   196 SNEEKTVIYVLSKKPDLTEIQQQLQVTQSEAKVQKPEVYFIKYKTQEEAQRAQQEIQAQYDALGG 260
            :|||||||||||||   .|.....:|.:..:...||||:||||||.|||..|||:||||||||||
  Fly   131 ANEEKTVIYVLSKK---GESDLNAEVVEQASSTSKPEVFFIKYKTNEEAAHAQQQIQAQYDALGG 192

  Fly   261 ATHISDEGVAPIASV------SSGSLNLGSFVPQHSQAGQTI 296
            ::.::||||||:.||      |.|.::.||.|.. :.|||.:
  Fly   193 SSQLTDEGVAPVTSVIGALGGSDGHIDGGSVVGA-TGAGQIV 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlFNP_649443.1 DM5 137..241 CDD:214776 48/103 (47%)
TwdlVNP_649446.1 DM5 78..173 CDD:214776 47/102 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443755
Domainoid 1 1.000 72 1.000 Domainoid score I16253
eggNOG 1 0.900 - - E1_2F8V1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2679
76.840

Return to query results.
Submit another query.