DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlF and TwdlE

DIOPT Version :9

Sequence 1:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_609157.3 Gene:TwdlE / 34075 FlyBaseID:FBgn0031957 Length:197 Species:Drosophila melanogaster


Alignment Length:244 Identity:72/244 - (29%)
Similarity:94/244 - (38%) Gaps:96/244 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLMCLVALTATAPQ----GYKYQPQLPALPIGNLRPLTPISSSGIYASGAVPSFPQAGAQPAIG 65
            ||||.|.||.|..|:    .|...|                      :|...||.|..|      
  Fly     8 VVLMALAALVAARPEPPRDSYSAPP----------------------SSSYQPSGPSGG------ 44

  Fly    66 VQPAIQAVQTIVAAPAPAPAPAPLSISLPKETFLTASPQQNLISTVQQQPQQIVYQQQPQQALQT 130
                       ..||||...|                                     ||||   
  Fly    45 -----------YGAPAPQYGP-------------------------------------PQQA--- 58

  Fly   131 QFVQRPAIVTKDIYIHSAPEENEELRQDEPLLENVPIRKNYRIVFIKAPSQNLKYTAAALKRAQS 195
                  .::.|.:|:|..|.|.|.....:||....| :|:|:||||||||..:. ||..:.:. .
  Fly    59 ------PVIHKHVYVHVPPPEPEYQAPRKPLYVPPP-QKHYKIVFIKAPSPPVP-TAPVIPQF-P 114

  Fly   196 SNEEKTVIYVLSKKPDLTEIQQQLQV-TQSEAKVQKPEVYFIKYKTQEE 243
            .|||||::|||.|||   |.|.::.: |.:..:..|||||||:||||:|
  Fly   115 QNEEKTLVYVLVKKP---EEQPEIIIPTPAPTQPSKPEVYFIRYKTQKE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlFNP_649443.1 DM5 137..241 CDD:214776 44/104 (42%)
TwdlENP_609157.3 DM5 59..158 CDD:214776 44/104 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.