DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TwdlF and TwdlZ

DIOPT Version :9

Sequence 1:NP_649443.1 Gene:TwdlF / 40534 FlyBaseID:FBgn0037224 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_728018.2 Gene:TwdlZ / 318092 FlyBaseID:FBgn0052569 Length:210 Species:Drosophila melanogaster


Alignment Length:223 Identity:86/223 - (38%)
Similarity:122/223 - (54%) Gaps:49/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NLISTVQQQPQQIVYQQQPQQALQTQFVQRPAIVTKDIYIHSAPEENEELRQDEPLLENVPI--- 167
            :|||....|..:  |...|..|::       .|:||..|..|..|:.|:|   ||..:::.|   
  Fly    11 SLISLSWAQGSR--YLPPPNPAME-------PIITKQFYSISPAEDPEDL---EPRTKHLVIGQP 63

  Fly   168 RKNYRIVFIKAP---SQNLKYTAAALKRAQSSNEEKTVIYVLSKKPDLTEIQQQLQVT-----QS 224
            |:|||::||:||   |:::||||..     :..||:||||||::|      ||:|:..     |.
  Fly    64 RRNYRVIFIRAPTGNSEHVKYTAEL-----APQEERTVIYVLTRK------QQELEAADIMAPQQ 117

  Fly   225 EAKV-QKPEVYFIKYKTQEEAQRAQQEIQAQYDALGGATHISDEGVAPIASVSSGSLNLGSFVPQ 288
            :::| |||:|:||||||.:||..||:|||.|||.|||.|.|:...||||.|| .|:|:    .||
  Fly   118 KSQVEQKPDVFFIKYKTNDEAAAAQREIQTQYDQLGGNTEIAAPYVAPIKSV-IGALS----SPQ 177

  Fly   289 HSQAGQTI------IHSQAP---TIIQP 307
            :..|...:      .|...|   ||:.|
  Fly   178 YPAAPYPVQRQSPGYHYDRPDRSTILAP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TwdlFNP_649443.1 DM5 137..241 CDD:214776 47/115 (41%)
TwdlZNP_728018.2 DUF243 36..132 CDD:281144 43/109 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F8V1
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000952
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31927
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.