DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and TMPRSS11D

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_004253.1 Gene:TMPRSS11D / 9407 HGNCID:24059 Length:418 Species:Homo sapiens


Alignment Length:394 Identity:100/394 - (25%)
Similarity:155/394 - (39%) Gaps:93/394 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EEKMWFHITDFQFDRVEGPTQ-PKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRLCEQKYSEY 124
            ::|.:|:.:.||...||..:| ..|..::|  ..:.|:     ......|..|:..|..|....:
Human    44 DQKSYFYRSSFQLLNVEYNSQLNSPATQEY--RTLSGR-----IESLITKTFKESNLRNQFIRAH 101

  Fly   125 VERIFPNDTAVAADA----------NDADFDGRV------------------------------- 148
            |.::..:.:.|.||.          |.|....|:                               
Human   102 VAKLRQDGSGVRADVVMKFQFTRNNNGASMKSRIESVLRQMLNNSGNLEINPSTEITSLTDQAAA 166

  Fly   149 ---LARPGEYPHMAAV-------GFESDRG----QVD------YKCGGSLISERFVLTAAHCTSI 193
               :...|..|.:..:       |.|::.|    ||.      :.||||||:..::||||||...
Human   167 NWLINECGAGPDLITLSEQRILGGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTAAHCFRS 231

  Fly   194 YEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPV 258
            ...|..|:....:.....|..     :|:..:..|.|||...:.:||||::||..|..|:.:..|
Human   232 NSNPRDWIATSGISTTFPKLR-----MRVRNILIHNNYKSATHENDIALVRLENSVTFTKDIHSV 291

  Fly   259 RLWVFPEL-----PTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLE 318
            .|   |..     |.:.|:..|:||..:|......|....:.::.|..|||   |.:.. ..:|.
Human   292 CL---PAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVCNA---PHSYN-GAILS 349

  Fly   319 SQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSF 382
            ..:||.......|.|||||||||.      :...|..:.::||.|:|..| ....|.|||||:::
Human   350 GMLCAGVPQGGVDACQGDSGGPLV------QEDSRRLWFIVGIVSWGDQCGLPDKPGVYTRVTAY 408

  Fly   383 LDWI 386
            ||||
Human   409 LDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/298 (27%)
Tryp_SPc 146..386 CDD:214473 78/296 (26%)
TMPRSS11DNP_004253.1 SEA 48..143 CDD:279699 20/101 (20%)
Tryp_SPc 186..412 CDD:214473 75/243 (31%)
Tryp_SPc 187..415 CDD:238113 77/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.