DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss12

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_445956.1 Gene:Prss12 / 85266 RGDID:69238 Length:761 Species:Rattus norvegicus


Alignment Length:252 Identity:81/252 - (32%)
Similarity:119/252 - (47%) Gaps:38/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIY--EAPPKWVRIGDL-DLASEKRS 214
            |.:|..|::..:|..|.....||.:|:|..:|||||||.:.|  .:....||:||. .|..|...
  Rat   526 GAWPWQASLRLKSTHGDGRLLCGATLLSSCWVLTAAHCFTRYGNNSRSYAVRVGDYHTLVPEGFE 590

  Fly   215 VEAQLLRIEQVFAHPNYKKKMYYDDIALLKL----EKEVELTEYVRPVRLWVFPELPTTIA---F 272
               |.:.::|:..|.||:......||||::|    |:...|:.:|.|..|.::.|.|...|   .
  Rat   591 ---QDIGVQQIVIHRNYRPDSSDYDIALVRLQGSGEQCARLSTHVLPACLPLWRERPQKTASNCH 652

  Fly   273 AMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQ-ICA----QDYILNR-D 331
            ..|:|.|..|...|  |....:.::|...|.       |...|:...: :||    :|   || |
  Rat   653 ITGWGDTGRAYSRT--LQQAAVPLLPKRFCK-------ERYKGLFTGRMLCAGNLQED---NRVD 705

  Fly   332 TCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFCR-SSYPSVYTRVSSFLDWIE 387
            :|||||||||....|...      :.:.|:||:|..|. ...|.|||||.:|:.||:
  Rat   706 SCQGDSGGPLMCEKPDET------WVVYGVTSWGYGCGIKDTPGVYTRVPAFVPWIK 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/250 (32%)
Tryp_SPc 146..386 CDD:214473 79/249 (32%)
Prss12NP_445956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..89
KR 83..159 CDD:214527
SR 166..265 CDD:214555
SRCR 171..266 CDD:278931
SR 273..372 CDD:214555
SRCR 278..371 CDD:278931
SR 386..485 CDD:214555
SRCR 391..485 CDD:278931
Zymogen activation region. /evidence=ECO:0000250 505..516
Tryp_SPc 516..755 CDD:214473 79/249 (32%)
Tryp_SPc 517..758 CDD:238113 81/252 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.