DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Cfi

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_077071.1 Gene:Cfi / 79126 RGDID:620429 Length:604 Species:Rattus norvegicus


Alignment Length:253 Identity:75/253 - (29%)
Similarity:110/253 - (43%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCT--SIYEAPPKWVRIGDLDLASEK 212
            |..|:||...|:. :.||    ..|||..|...::||||||.  |.|.....|..:.|....:.:
  Rat   368 AEMGDYPWQVAIK-DGDR----ITCGGIYIGGCWILTAAHCVRPSRYRNYQVWTSLLDWLKPNSQ 427

  Fly   213 RSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKL-----EKEVELTEYVRPVRLWVFPEL--PTTI 270
            .:|:.    :.:|..|..|....|.:||||:::     :||.||...|.....| .|.|  |...
  Rat   428 LAVQG----VSRVVVHEKYNGATYQNDIALVEMKKHPGKKECELINSVPACVPW-SPYLFQPNDR 487

  Fly   271 AFAMGYG-ATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQI-CAQDYILNRDTC 333
            ....|:| .....|..:.|...::|.    ..|:...      |....|.:: ||.....:.|.|
  Rat   488 CIISGWGREKDNQKVYSLRWGEVDLI----GNCSRFY------PGRYYEKEMQCAGTSDGSIDAC 542

  Fly   334 QGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIELTV 390
            :|||||||..     :..:.:.| :.||.|:|..| :..:|.|||||:|:.|||...|
  Rat   543 KGDSGGPLVC-----KDVNNVTY-VWGIVSWGENCGKPEFPGVYTRVASYFDWISYYV 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 73/248 (29%)
Tryp_SPc 146..386 CDD:214473 72/247 (29%)
CfiNP_077071.1 FIMAC 46..111 CDD:214493
SR 117..220 CDD:214555
SRCR 122..219 CDD:278931
LDLa 228..258 CDD:197566
LDLa 264..298 CDD:294076
Tryp_SPc 361..590 CDD:214473 72/247 (29%)
Tryp_SPc 362..591 CDD:238113 73/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.