DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and mettl7a

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001072195.1 Gene:mettl7a / 779641 XenbaseID:XB-GENE-5802614 Length:245 Species:Xenopus tropicalis


Alignment Length:175 Identity:33/175 - (18%)
Similarity:65/175 - (37%) Gaps:43/175 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISE----RFVLTA 187
            :.:||:..|.....:.:|:..::....|..|:              |..|||::.    :.|..|
 Frog    86 KFYPNNCRVTCLDINPNFEKFLVKSQAENSHL--------------KFEGSLVASADNMKQVADA 136

  Fly   188 AH----CTSIYEAPPKWVRIGD------------LDLASEKRSVEAQLLRIEQVFAHPNYKKKMY 236
            :.    ||.:..:.|...::.:            ..|.....|.||..|...|...:|.:  |:.
 Frog   137 SQDVVVCTLVVCSVPNTPKVLEEVWRVLKPGGAFFFLEHVACSDEATWLCFFQRILNPTW--KLV 199

  Fly   237 YDDIALLKLE-KEVELTEY----VRPV--RLWVFPELPTTIAFAM 274
            :|...|.|.. |::|..::    :|.:  |..:.|..|..:.:|:
 Frog   200 FDGCNLRKFTWKDLENAKFSTLKLRHIQARTMIKPVTPHIVGYAV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 29/156 (19%)
Tryp_SPc 146..386 CDD:214473 29/156 (19%)
mettl7aNP_001072195.1 Methyltransf_11 75..172 CDD:311935 15/99 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.