DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss4a

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_005157547.1 Gene:tmprss4a / 777630 ZFINID:ZDB-GENE-061103-631 Length:458 Species:Danio rerio


Alignment Length:256 Identity:75/256 - (29%)
Similarity:119/256 - (46%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 DADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTS--IYEAPPKWVRI 203
            |||.        ..:|...::.:.   ||  :.|||||::..:|:|||||.:  ..:|..:|..:
Zfish   229 DADI--------ANWPWQVSLQYS---GQ--HTCGGSLVTPNWVVTAAHCFNGDGRKALSRWTVV 280

  Fly   204 GDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT 268
            ..:...|...|     ..::::..:.|||......||.::||:..:.|:|..|||.|   |  |.
Zfish   281 SGITYLSSTPS-----SYVKEIIVNSNYKPAESDFDITMIKLQSPITLSESRRPVCL---P--PQ 335

  Fly   269 TIAFAMGYG--ATSFAK------PMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQD 325
            .:....|.|  .|.:..      .:::.|....:.|:.:|:|::  |.:  ..|.:....|||..
Zfish   336 NLGLKGGDGLVVTGWGHMAEKGGSLSSMLQKAQIQVIDSAQCSS--PTV--YGSSITPRMICAGV 396

  Fly   326 YILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDW 385
            .....|.||||||||| ::|..|       :.|:|:.|:||.| |..:|.|||.|...|||
Zfish   397 MAGGVDACQGDSGGPL-VHLADR-------WVLVGVVSWGVGCARPGFPGVYTNVDQMLDW 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/251 (29%)
Tryp_SPc 146..386 CDD:214473 72/251 (29%)
tmprss4aXP_005157547.1 LDLa 74..105 CDD:238060
SRCR_2 121..218 CDD:295335
Tryp_SPc 223..449 CDD:214473 73/254 (29%)
Tryp_SPc 224..449 CDD:238113 73/254 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.