DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Prss46

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_898926.2 Gene:Prss46 / 74306 MGIID:1921556 Length:314 Species:Mus musculus


Alignment Length:252 Identity:77/252 - (30%)
Similarity:121/252 - (48%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPKW-VRIGDLDLASEKRSVE 216
            |::|...::.|   .|.  |.|.||||...::||||||....:.|.|: |::|...|.....|  
Mouse    53 GKWPWQVSILF---LGM--YICSGSLIHHHWILTAAHCLQRSKNPAKYTVKVGVQTLPDNSTS-- 110

  Fly   217 AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT--TIAFAMGYG-A 278
             :|| :.::..|.|:..:| .||||:|||:..|..:..|:|:.|..|...|:  |:.:.:|:| .
Mouse   111 -ELL-VTRIVIHENFINRM-SDDIAILKLKYPVTWSPLVQPICLPSFNLKPSIGTMCWVVGWGLE 172

  Fly   279 TSFAKPMT-NRLTNLNLTVVPNAECNAELPPLAETPSGVLESQ--------IC-AQDYILNRDTC 333
            .:...|.| ..:..|.:.:|.|..||.....|      :|::|        :| :.::.|  |||
Mouse   173 KAEGHPKTPYSVQGLAVRIVNNEICNHRYQFL------LLKNQKKFIGNDMLCTSSEWGL--DTC 229

  Fly   334 QGDSGGPL--QLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            |..||..|  |:|..         :..:|:.|:...| |..:|||||..|.|..||:
Mouse   230 QDTSGSSLVCQMNKT---------WVQMGVVSWNFDCGRRQFPSVYTSTSHFTQWIK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/250 (30%)
Tryp_SPc 146..386 CDD:214473 75/249 (30%)
Prss46NP_898926.2 Tryp_SPc 43..276 CDD:214473 75/249 (30%)
Tryp_SPc 44..279 CDD:238113 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.