DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and tmprss4

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_012822151.1 Gene:tmprss4 / 733869 XenbaseID:XB-GENE-940762 Length:785 Species:Xenopus tropicalis


Alignment Length:239 Identity:69/239 - (28%)
Similarity:120/239 - (50%) Gaps:29/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 EYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAP-PKW-VRIGDLDLASEKRSVE 216
            :||...::.:   .||  :.||||:::.|::|.||||....:.. .:| |:.|...|.....:. 
 Frog   562 KYPWQVSLQY---MGQ--HICGGSILNSRWILCAAHCFDRGQRQVDRWRVQYGITTLTYLFGTF- 620

  Fly   217 AQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE--LPTTIAFAMGYGAT 279
                 ::::|.:..|......:|||||:|:.::..:..|:||.|..:..  :...:.:..|:|.|
 Frog   621 -----VDKIFLNSKYVTDQKPNDIALLQLKSDIVASASVQPVCLPGYDNNLVVGAVLYVTGWGHT 680

  Fly   280 -SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYILNRDTCQGDSGGPLQL 343
             .....:.::|..:.::::.:..||.|.      ...:|::.:||.......||||||||||| :
 Frog   681 VEGGAALASQLQEVAISLISSTTCNQEY------GGQILDTMLCAGKIAGGADTCQGDSGGPL-V 738

  Fly   344 NLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            :|     |...|:..:||.|:|..| |.:...|||.|.|||:||
 Frog   739 SL-----GQSSHWEQVGIVSWGDGCGRPNRVGVYTDVQSFLNWI 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/239 (29%)
Tryp_SPc 146..386 CDD:214473 67/237 (28%)
tmprss4XP_012822151.1 ATF7IP_BD <110..233 CDD:293393
PHA03193 <206..340 CDD:177555
LDLa 402..434 CDD:238060
SRCR_2 453..545 CDD:292133
SRCR 464..541 CDD:278931
Tryp_SPc 551..777 CDD:214473 67/237 (28%)
Tryp_SPc 552..777 CDD:238113 67/237 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.