DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and XB5723326

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:257 Identity:64/257 - (24%)
Similarity:121/257 - (47%) Gaps:52/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYK--CGGSLISERFVLTAAHCTSIYE----APPKWVRIG-----DL 206
            |::|.:.::   ..:.::.||  |.|::::..:::|||||...::    ..|..|.:|     ::
 Frog    25 GKWPWIVSI---QKKVELGYKHICAGTILNNEWIITAAHCFKDWKEGDPTTPLRVLLGTFYLSEI 86

  Fly   207 DLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE------ 265
            .|.::.|.|       :|:..|..|......:||||::|:|:||.:::::..   .||:      
 Frog    87 GLRTQSRGV-------KQLIKHDQYDPITESNDIALIQLDKQVEFSDHIQQA---CFPKESADLK 141

  Fly   266 --LPTTIAFAMGYGATS--FAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVL-ESQICAQD 325
              :..:||   |:||..  ..:| :..|....:..:....||       :...|:| |:.:||..
 Frog   142 DLIDCSIA---GWGAQGKHLDEP-SQFLQEAQVERIDTKHCN-------KWYQGILGENHLCAGH 195

  Fly   326 YILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            ......||.||.|.||..    |.:.:.: |.:|||.::|..| ::..|.||:.:.|.:.||
 Frog   196 RKGPEKTCNGDRGSPLMC----RTKKNNV-YSVIGILNWGSGCGQTRSPGVYSPIQSHIKWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 64/257 (25%)
Tryp_SPc 146..386 CDD:214473 62/255 (24%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 62/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.