DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and LOC683422

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006252253.1 Gene:LOC683422 / 683422 RGDID:1586868 Length:312 Species:Rattus norvegicus


Alignment Length:230 Identity:69/230 - (30%)
Similarity:106/230 - (46%) Gaps:45/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYD 238
            ||||:::|.:||:|:||..........:|.|..||:::....|    :::::..||.:...:..:
  Rat    71 CGGSILNEWWVLSASHCFDQINNANLEIRHGRDDLSTKNVKHE----KVDKLILHPKFDDWLLDN 131

  Fly   239 DIALLKLEKEVEL--------TEYVRPVRLWVFPELPTTIAFAMGYGAT--SFAKPMTNRLTNLN 293
            |||||.|:..:.|        |..:..:|:|       ...:..|:|.|  |..|..|.:|..:.
  Rat   132 DIALLLLKSPLNLSINGIPICTSELSDLRIW-------KNCWVTGWGITNVSGVKVQTTKLQKVQ 189

  Fly   294 LTVVPNAECNAELPPL------AETPSGVLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGH 352
            :.:.....|...||.|      |.||.|             ..|.|||||||.|..|   ::|..
  Rat   190 VDLFRWDWCGYVLPLLTKNMLCAGTPDG-------------GMDACQGDSGGALVCN---KKRNI 238

  Fly   353 RIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            ...|. :||.|:||.| :.:.|.|||:||.:|.||
  Rat   239 NTWYQ-VGIVSWGVGCGKKNLPGVYTKVSPYLKWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 69/230 (30%)
Tryp_SPc 146..386 CDD:214473 67/228 (29%)
LOC683422XP_006252253.1 Tryp_SPc 46..275 CDD:238113 69/230 (30%)
Tryp_SPc 46..272 CDD:214473 67/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.