DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and st14a

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001035441.2 Gene:st14a / 678603 ZFINID:ZDB-GENE-030131-6496 Length:834 Species:Danio rerio


Alignment Length:251 Identity:79/251 - (31%)
Similarity:120/251 - (47%) Gaps:43/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 GEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTS-----IYEAPPKW-VRIGDLDLASE 211
            ||:|...::..::    :.:.||||:|:||:::|||||..     .|..|..| |.:|   |.|:
Zfish   606 GEFPWQVSLHIKN----IAHVCGGSIINERWIVTAAHCVQDDVKIKYSQPGTWEVFLG---LHSQ 663

  Fly   212 KRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPELPT-------- 268
            |..:.|....::||..||.|....|.:||||:::|..|..::.:|||.      |||        
Zfish   664 KDKLTATKRLLKQVIPHPYYNAYTYDNDIALMEMESPVTFSDTIRPVC------LPTATDTFPAG 722

  Fly   269 TIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQI-CAQDYILNRDT 332
            |..|..|:|||.........|....:.::.:..||       :...|.:.|:: ||.......|.
Zfish   723 TSVFISGWGATREGGSGATVLQKAEVRIINSTVCN-------QLMGGQITSRMTCAGVLSGGVDA 780

  Fly   333 CQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            ||||||||  |:.|..:|     ..|.|:.|:|..| |.:.|.:|:.|..|..||:
Zfish   781 CQGDSGGP--LSFPSGKR-----MFLAGVVSWGDGCARRNKPGIYSNVPKFRAWIK 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 78/249 (31%)
Tryp_SPc 146..386 CDD:214473 77/248 (31%)
st14aNP_001035441.2 SEA 77..168 CDD:279699
CUB 219..322 CDD:238001
CUB 329..431 CDD:238001
LDLa 443..472 CDD:238060
LDLa 474..508 CDD:238060
LDLa 510..544 CDD:238060
LDLa 550..585 CDD:238060
Tryp_SPc 596..828 CDD:214473 77/248 (31%)
Tryp_SPc 597..831 CDD:238113 79/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.