DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and ST14

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_068813.1 Gene:ST14 / 6768 HGNCID:11344 Length:855 Species:Homo sapiens


Alignment Length:285 Identity:84/285 - (29%)
Similarity:123/285 - (43%) Gaps:55/285 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 DTAVAADANDADFDGRVLAR-----------PGEYP---HMAAVGFESDRGQVDYKCGGSLISER 182
            |.:..:|..|.|...|...|           .||:|   .:.|:|    :|.:   ||.||||..
Human   592 DCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQVSLHALG----QGHI---CGASLISPN 649

  Fly   183 FVLTAAHC-----TSIYEAPPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIAL 242
            ::::||||     ...|..|.:|.....|...|::.:...|..|::::.:||.:....:..||||
Human   650 WLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISHPFFNDFTFDYDIAL 714

  Fly   243 LKLEKEVELTEYVRPVRL----WVFPELPTTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECN 303
            |:|||..|.:..|||:.|    .|||  .....:..|:|.|.:.......|....:.|:....|.
Human   715 LELEKPAEYSSMVRPICLPDASHVFP--AGKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCE 777

  Fly   304 AELPPLAETPS----GVLESQICAQDYILNRDTCQGDSGGPL-QLNLPGRRRGHRIHYHLIGITS 363
             .|.|...||.    |.|...:         |:||||||||| .:...||       ....|:.|
Human   778 -NLLPQQITPRMMCVGFLSGGV---------DSCQGDSGGPLSSVEADGR-------IFQAGVVS 825

  Fly   364 YGVFC-RSSYPSVYTRVSSFLDWIE 387
            :|..| :.:.|.||||:..|.|||:
Human   826 WGDGCAQRNKPGVYTRLPLFRDWIK 850

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 79/269 (29%)
Tryp_SPc 146..386 CDD:214473 78/268 (29%)
ST14NP_068813.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
SEA 88..>171 CDD:307516
CUB 227..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 488..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060 2/9 (22%)
Tryp_SPc 615..852 CDD:238113 78/262 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.