DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:251 Identity:73/251 - (29%)
Similarity:120/251 - (47%) Gaps:52/251 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 GFESDRGQVDYK---------CGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEKRSVEA 217
            |:...|..:.|:         ||||||:.::|::||||   |::..: ||:|:       .:::|
Mouse    28 GYTCQRNALPYQVSLNSGYHFCGGSLINSQWVVSAAHC---YKSRIQ-VRLGE-------HNIDA 81

  Fly   218 -----QLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFP-ELPT--TIAFAM 274
                 |.:...::..||||....|.:||.|:||:....|...|..|.|   | ..|:  |.....
Mouse    82 LEGGEQFIDAAKIIRHPNYNANTYNNDIMLIKLKTAATLNSRVSTVAL---PRSCPSAGTRCLVS 143

  Fly   275 GYGAT-SFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYIL-NRDTCQGDS 337
            |:|.| |......:.|..|:..|:.::.|.:..|       |.:.|.:....::. .:|:|||||
Mouse   144 GWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSSYP-------GKITSNMFCLGFLEGGKDSCQGDS 201

  Fly   338 GGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIELTVWA 392
            |||:..|  |:         |.|:.|:|..| :...|.|||:|..:::||:.|:.|
Mouse   202 GGPVVCN--GQ---------LQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQTIAA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 70/244 (29%)
Tryp_SPc 146..386 CDD:214473 69/243 (28%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 69/243 (28%)
Tryp_SPc 25..243 CDD:238113 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.