DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and PRSS56

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001356777.1 Gene:PRSS56 / 646960 HGNCID:39433 Length:604 Species:Homo sapiens


Alignment Length:321 Identity:92/321 - (28%)
Similarity:137/321 - (42%) Gaps:67/321 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 GPTQPKPKPRQYPPPPMPGQPFPPPPGGFKKKENKQRRLCEQKYSEYVERIFPNDTAVAADANDA 142
            |..:|:|:.....||       .|.|.|       :||                    .:.||..
Human    69 GSGRPRPQALLQDPP-------EPGPCG-------ERR--------------------PSTANVT 99

  Fly   143 DFDGRVL----ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHCTSIYEAPPK--WV 201
            ...||::    |.||.:|.:..:..   .||.  .|||.|::..:|||||||  ...||.:  |.
Human   100 RAHGRIVGGSAAPPGAWPWLVRLQL---GGQP--LCGGVLVAASWVLTAAHC--FVGAPNELLWT 157

  Fly   202 RIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPEL 266
                :.||...|..:|:.:.:.::..||.:..:.:::|:||::|...|......|||.|...|:.
Human   158 ----VTLAEGSRGEQAEEVPVNRILPHPKFDPRTFHNDLALVQLWTPVSPGGSARPVCLPQEPQE 218

  Fly   267 P---TTIAFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQICAQDYIL 328
            |   |..|.| |:||.....|....:....:.::....|...|.|      |:..|.:....|:.
Human   219 PPAGTACAIA-GWGALFEDGPEAEAVREARVPLLSTDTCRRALGP------GLRPSTMLCAGYLA 276

  Fly   329 NR-DTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWIE 387
            .. |:|||||||||..:.||.|.    ...|.|:||:|..| ....|.|||||:.|.||::
Human   277 GGVDSCQGDSGGPLTCSEPGPRP----REVLFGVTSWGDGCGEPGKPGVYTRVAVFKDWLQ 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/251 (32%)
Tryp_SPc 146..386 CDD:214473 79/250 (32%)
PRSS56NP_001356777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..96 10/60 (17%)
Tryp_SPc 105..335 CDD:238113 78/251 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..475
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.