DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001028824.2 Gene:Tmprss11d / 64565 RGDID:620654 Length:417 Species:Rattus norvegicus


Alignment Length:314 Identity:83/314 - (26%)
Similarity:141/314 - (44%) Gaps:55/314 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FKKKENKQRRLCEQKYSEYVERIFPNDTAVAADAN------DADFDGRVLARPGEYPHMAAV--- 161
            |:..:...::..:.:....::|:..:.....|.:|      |.|.:..:....|..|.:..:   
  Rat   120 FRSSKRNNKKAMKTRIQSVLQRLSSSGNLEIAPSNEITSLTDQDTENVLTQECGARPDLITLSEE 184

  Fly   162 ----GFESDRG----QVD------YKCGGSLISERFVLTAAHCTSIYEAPPKWVRIGDLDLASEK 212
                |.:::.|    ||.      :.|||:|||..:|||||||...|..|.:|.....:...|.:
  Rat   185 RIIGGTQAETGDWPWQVSLQLNNVHHCGGTLISNLWVLTAAHCFRSYSNPQQWTATFGVSTISPR 249

  Fly   213 RSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWVFPE--LPTTIAFAMG 275
            ..|     |:..:.||..|......:|||:::|::.|..|..:..|.|....:  :|.::|:..|
  Rat   250 LRV-----RVRAILAHAEYNSITRDNDIAVVQLDRPVTFTRNIHRVCLPAATQNIIPDSVAYVTG 309

  Fly   276 YGATSFAKPMTNRLTNL---NLTVVPNAECNAELPPLAETPSG----VLESQICAQDYILNRDTC 333
            :|:.::.   .|.:|||   .:.:|.:..||        .|:|    ||...:||.......|.|
  Rat   310 WGSLTYG---GNTVTNLQQGEVRIVSSEVCN--------EPAGYGGSVLPGMLCAGVRSGAVDAC 363

  Fly   334 QGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVFC-RSSYPSVYTRVSSFLDWI 386
            ||||||||.      :...|..:.::||.|:|..| ..:.|.|||||:::.:||
  Rat   364 QGDSGGPLV------QEDTRRLWFVVGIVSWGYQCGLPNKPGVYTRVTAYRNWI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 77/268 (29%)
Tryp_SPc 146..386 CDD:214473 75/266 (28%)
Tmprss11dNP_001028824.2 SEA 48..150 CDD:396113 2/29 (7%)
Tryp_SPc 186..414 CDD:238113 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.