DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and zgc:123217

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:267 Identity:78/267 - (29%)
Similarity:121/267 - (45%) Gaps:61/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 ARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVLTAAHC-------------------TSIYE 195
            |..|.:|...::.:.:     .:.|||:||..::|:|||||                   ||:  
Zfish    43 APAGSWPWQVSIHYNN-----RHICGGTLIHSQWVMTAAHCIINTNINVWTLYLGRQTQSTSV-- 100

  Fly   196 APPKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRL 260
            |.|..|::|                 |:.:..||::...:..:||:|:||.:.|..:.|:||:.|
Zfish   101 ANPNEVKVG-----------------IQSIIDHPSFNNSLLNNDISLMKLSQPVNFSLYIRPICL 148

  Fly   261 WVFPEL--PTTIAFAMGYG--ATSFAKPMTNRLTNLNLTVVPNAECNAELPPLAETPSGVLESQI 321
            .....:  ..|..:|.|:|  ....|.|....|..:.:.||.|:.|:.|...:  ..:.:....|
Zfish   149 AANNSIFYNGTSCWATGWGNIGKDQALPAPQTLQQVQIPVVANSLCSTEYESV--NNATITPQMI 211

  Fly   322 CAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYGVF--CR-SSYPSVYTRVSSFL 383
            ||..  .|:.|||||||||.|.     ::|.  .:...||||||..  |. .:||.||:|||.|.
Zfish   212 CAGK--ANKGTCQGDSGGPFQC-----KQGS--VWIQAGITSYGTSAGCAVGAYPDVYSRVSEFQ 267

  Fly   384 DWIELTV 390
            .||::.|
Zfish   268 SWIKMNV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 76/262 (29%)
Tryp_SPc 146..386 CDD:214473 75/261 (29%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 75/261 (29%)
Tryp_SPc 37..273 CDD:238113 77/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.