DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and Masp1

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_006248588.1 Gene:Masp1 / 64023 RGDID:620213 Length:733 Species:Rattus norvegicus


Alignment Length:340 Identity:89/340 - (26%)
Similarity:143/340 - (42%) Gaps:89/340 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RRLCEQKY--------------------SEYVERIFPNDTAVAADANDA--DFDGRVL----ARP 152
            |..|:|.|                    :|.::|..|....|....:.|  :...|::    |..
  Rat   399 RYSCQQPYYKMLHNTTGVYTCSAHGTWTNEVLKRSLPTCLPVCGQPSRALPNLVKRIIGGRNAEL 463

  Fly   153 GEYPHMAAVGFESDRGQV--DYKCG-GSLISERFVLTAAHC-----------------TSIYEAP 197
            |.:|..|.:..| |..::  |...| |:|:||.::|||||.                 .::|   
  Rat   464 GLFPWQALIVVE-DTSRIPNDKWFGSGALLSESWILTAAHVLRSQRRDNTVIPVSKDHVTVY--- 524

  Fly   198 PKWVRIGDLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYYDDIALLKLEKEVELTEYVRPVRLWV 262
                 :|..|:..:..:|.:...|   |..||::..:.|..||||::|::.|.|..:|.|:.| .
  Rat   525 -----LGLHDVRDKSGAVNSSAAR---VVLHPDFNIQNYNHDIALVQLQEPVPLGAHVMPICL-P 580

  Fly   263 FPE----LPTTIAFAMGYGAT-----------SFAKPMTNRLTNLNLTVVPNAECNAELPPLAET 312
            .||    .|..:....|:|.:           |..:.:::.|..:.|.||.:|||.|..    |:
  Rat   581 RPEPEGPAPHMLGLVAGWGISNPNVTVDEIIISGTRTLSDVLQYVKLPVVSHAECKASY----ES 641

  Fly   313 PSG---VLESQICAQDYILNRDTCQGDSGGPLQLNLPGRRRGHRIHYHLIGITSYG--VFCRSSY 372
            .||   |.|:..||..|...:|||.|||||...:.....:|     :...|:.|:|  ..|.|..
  Rat   642 RSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDEMSQR-----WVAQGLVSWGGPEECGSKQ 701

  Fly   373 P-SVYTRVSSFLDWI 386
            . .|||:||:::||:
  Rat   702 VYGVYTKVSNYVDWL 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 80/286 (28%)
Tryp_SPc 146..386 CDD:214473 79/284 (28%)
Masp1XP_006248588.1 CUB 33..142 CDD:238001
FXa_inhibition 158..186 CDD:291342
CUB 190..299 CDD:278839
CCP 306..368 CDD:153056
CCP 372..437 CDD:153056 7/37 (19%)
Tryp_SPc 454..715 CDD:214473 78/282 (28%)
Tryp_SPc 455..716 CDD:238113 78/282 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.