DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and CELA2A

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_254275.1 Gene:CELA2A / 63036 HGNCID:24609 Length:269 Species:Homo sapiens


Alignment Length:286 Identity:87/286 - (30%)
Similarity:131/286 - (45%) Gaps:57/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 YSEYVERIFPNDTAVAADANDADFDGRVLARPGEYPHMAAVGFESDRGQVDYKCGGSLISERFVL 185
            |..||.|:.                |...|||..:|...::.:.|: |:..:.||||||:..:||
Human    22 YPPYVTRVV----------------GGEEARPNSWPWQVSLQYSSN-GKWYHTCGGSLIANSWVL 69

  Fly   186 TAAHCTSIYEAPPKWVRIG----DLDLASEKRSVEAQLLRIEQVFAHPNYKKKMYY--DDIALLK 244
            |||||.|    ..:..|:|    :|.:| |..|:   .:.:.::..|.::......  :||||||
Human    70 TAAHCIS----SSRTYRVGLGRHNLYVA-ESGSL---AVSVSKIVVHKDWNSNQISKGNDIALLK 126

  Fly   245 LEKEVELTEYVRPVRLWVFPELPTTI-----AFAMGYGATSFAKPMTNRLTNLNLTVVPNAECNA 304
            |...|.||:   .::|...|...|.:     .:..|:|.......:.:.|....|.||..|.|::
Human   127 LANPVSLTD---KIQLACLPPAGTILPNNYPCYVTGWGRLQTNGAVPDVLQQGRLLVVDYATCSS 188

  Fly   305 ELPPLAETPSGVLESQICA-QDYILNRDTCQGDSGGPLQLNL-PGRRRGHRIHYHLIGITSYGVF 367
            .    |...|.|..|.||| .|.:::  :|.|||||||.... .||.:.|       ||.|:|..
Human   189 S----AWWGSSVKTSMICAGGDGVIS--SCNGDSGGPLNCQASDGRWQVH-------GIVSFGSR 240

  Fly   368 CRSSY---PSVYTRVSSFLDWIELTV 390
            ...:|   |||:||||:::|||...:
Human   241 LGCNYYHKPSVFTRVSNYIDWINSVI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 82/256 (32%)
Tryp_SPc 146..386 CDD:214473 81/255 (32%)
CELA2ANP_254275.1 Tryp_SPc 29..265 CDD:238113 83/276 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.