DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14642 and c1s

DIOPT Version :9

Sequence 1:NP_001246901.1 Gene:CG14642 / 40532 FlyBaseID:FBgn0037222 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_002941253.2 Gene:c1s / 613055 XenbaseID:XB-GENE-995410 Length:691 Species:Xenopus tropicalis


Alignment Length:303 Identity:82/303 - (27%)
Similarity:144/303 - (47%) Gaps:64/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 NKQRRLCEQKYSEYVERIFPNDTAVAADANDADFDGRVL----ARPGEYPHMAAVGF-ESDRGQV 170
            ||:..:|               |.|.. .:.:|..||:.    |:||::|.|  :.| :.:.|  
 Frog   416 NKELPIC---------------TPVCG-VHQSDKSGRIFGGTRAKPGQFPWM--IQFTDIELG-- 460

  Fly   171 DYKCGGSLISERFVLTAAHCTSIYEAPPKWVRI----GDLDLASEKRSVEAQLLRIEQVFAHPNY 231
                ||||||:|:||||||..:....|..:..:    .:.:|.|:::.::|     :::..||.|
 Frog   461 ----GGSLISDRWVLTAAHVVNKKIFPTMFGGVMKFFPNTNLQSQEKRLQA-----KKIIIHPLY 516

  Fly   232 K-------KKMYYDDIALLKLEKEVELTEYVRPV---RLWVFPELPTTIAFAMGYGATSFAKPMT 286
            :       :..:.:||||::|.|:|:|...:.|:   |..:.| :...:|...|:|.|...:...
 Frog   517 QDNEDTEGQSNFDNDIALVQLTKKVKLGSCISPICLPRRGLAP-VVNEVATIAGWGKTEKRESAV 580

  Fly   287 N-RLTNLNLTVVPNAECNAELPPLAETPSGVL-ESQICAQDYILNRDTCQGDSGGPLQLNLPGRR 349
            | :..:::|:.:.  :|..     |....|.. .:.:||...: .:|:|.|||||||....|   
 Frog   581 NLQFASISLSSMD--KCKK-----ATGGKGYFTPNMLCAGSDV-GKDSCNGDSGGPLMFTDP--- 634

  Fly   350 RGHRIHYHLIGITSYGVFCRSSYPSVYTRVSSFLDWIELTVWA 392
             ......::.||.|:|.....:| .:||:|.::|||||.|:.|
 Frog   635 -QDSSKMYMAGIVSWGPRDCGTY-GLYTKVDNYLDWIEETIAA 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14642NP_001246901.1 Tryp_SPc 146..387 CDD:238113 72/261 (28%)
Tryp_SPc 146..386 CDD:214473 71/260 (27%)
c1sXP_002941253.2 CUB 21..131 CDD:238001
FXa_inhibition 145..173 CDD:405372
CUB 177..288 CDD:238001
PHA02927 301..>436 CDD:222943 6/35 (17%)
Tryp_SPc 436..669 CDD:214473 70/259 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.